close all open/close all

CDS information : Resis_00050


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction3,023 / 4,066 / + [in whole cluster]
3,023 / 4,066 / + [in contig]
Location3023..4066 [in whole cluster]
3023..4066 [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative methyltransferase
Product (GenBank)RemH protein
Gene
Gene (GenBank)remH
EC number2.1.1.-
Keyword
Note
  • This ORF is not involved in resistomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[17914826] Geminal tandem C-methylation in the discoid resistomycin pathway. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q70DX4
NITE
Resis_00040
PmId
[17914826] Geminal tandem C-methylation in the discoid resistomycin pathway. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative methyltransferase [RemH protein]
MTDTPVRAAPPASPAAALARYTTAPDPGPLLALNFGFARARALGTALELGVFTALARRPR
GTEDLAAALGCDPRALGDLLAVLTEFGLLTGDGQGLTELSRAYLVEGEPTYLGDHFAEVL
GQWDRWSALTPVTRSGDRSGDFGAPAARGRHPGLFGGGFPLAVRVAFAAVEALGLRRAGR
VLDLACGGGEWGIALAAADPRAEVTAHDDPVLLGSARARAAEFGVADRFRFVSADFAAPP
FADAGFDTVVLAHAGRFAGPTATARLVRECARQLRPGGTLLVADVMRPEPGRPALSRPML
GLSLLVNTADGAVLAAQDYRALMEDAGVTAKECVTRGLVTAQTGKRR
selected fasta
>putative methyltransferase [RemH protein]
ATGACGGACACCCCGGTGCGGGCCGCGCCGCCCGCCTCCCCCGCAGCGGCCCTCGCCCGC
TACACGACCGCCCCCGACCCGGGCCCGCTGCTCGCCCTCAACTTCGGCTTCGCCAGGGCC
AGAGCCCTCGGTACGGCCCTGGAACTGGGCGTCTTCACCGCGCTGGCACGGCGCCCACGC
GGCACCGAGGACCTCGCCGCCGCCCTCGGCTGCGACCCCCGGGCCCTGGGCGACCTGCTG
GCCGTCCTCACCGAGTTCGGACTGCTCACCGGTGACGGGCAGGGTCTGACCGAGCTCTCC
CGCGCCTACCTCGTCGAGGGCGAACCCACCTACCTGGGCGACCACTTCGCCGAGGTGCTC
GGCCAGTGGGACCGGTGGAGCGCGCTGACCCCGGTCACCCGCTCCGGCGACCGCTCCGGG
GACTTCGGCGCCCCCGCCGCGCGCGGCCGCCACCCCGGACTGTTCGGCGGCGGTTTCCCG
CTCGCCGTCCGGGTCGCCTTCGCGGCCGTCGAGGCCCTGGGGCTGCGCCGGGCGGGCCGG
GTGCTGGACCTGGCCTGCGGGGGCGGCGAGTGGGGCATCGCCCTGGCCGCCGCCGATCCG
CGGGCCGAGGTGACCGCGCACGACGATCCGGTGCTGCTCGGGTCGGCCCGCGCGCGGGCG
GCGGAGTTCGGGGTGGCCGACAGGTTCCGGTTCGTGTCCGCCGACTTCGCCGCTCCGCCG
TTCGCCGACGCCGGTTTCGACACCGTGGTGCTGGCGCACGCGGGCCGCTTCGCCGGGCCC
ACGGCCACGGCCCGGCTGGTGCGGGAGTGCGCCCGGCAGCTCCGCCCCGGCGGCACCCTG
CTGGTGGCCGACGTGATGCGGCCGGAGCCGGGGCGGCCCGCGCTGAGCCGGCCGATGCTC
GGGCTCAGCCTTCTGGTCAACACCGCGGACGGGGCCGTACTCGCCGCGCAGGACTACCGC
GCCCTCATGGAGGACGCCGGTGTGACGGCGAAGGAATGCGTAACGCGCGGGCTGGTGACG
GCCCAGACAGGGAAAAGGCGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [24-95]  1.1e-20 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit