close all open/close all

CDS information : Resis_00060


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction4,069 / 5,355 / + [in whole cluster]
4,069 / 5,355 / + [in contig]
Location4069..5355 [in whole cluster]
4069..5355 [in contig]
TypeCDS
Length1,287 bp (428 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)RemA protein
Gene
Gene (GenBank)remA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)
Related Reference
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS1..380

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [RemA protein]
MREVVVTGLGVISPAGIGKEAFWDTVSAGKSVTKSLSDITSSSLFKSFEFASDAIAEVPG
FEEQIPSLPPEVQRLDRYVQFAVAAALQAVRDAGLQDGGHDAERTGISLSTAICGTPRME
EEFLAVTDEGRRPIDPAKAGRDLYLAAMSNTPGTVLSALLGAQGPCVTLSTGCIGGIDAV
GHAYESIAHGDADVMIAGASEAPITPVTVASFEIINCLSRAHRGHPEAASRPYDADRDGF
VLGEGCGIVVLEEKEHALRRGATPYLQISGFSHTSNAIHMTDLLSDGEDLTRAMSQAIEV
SGVAPGAIDHVSSHGSSTRQNDTCETSALKLALGERAREIPVNSAKSMLGHALAAASAME
IVLCALAGRHSFVHPTANYETPDPTCDLDYVPGTGRPWDGEVILKDASGFAGLHAAMVAR
TVRDGGRS
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [RemA protein]
ATGCGAGAAGTGGTCGTCACCGGGCTAGGCGTGATCAGCCCGGCGGGAATCGGGAAAGAA
GCCTTCTGGGACACGGTCTCGGCGGGAAAAAGCGTCACGAAATCCCTTTCCGACATCACG
AGTTCCTCCCTTTTCAAGTCCTTCGAATTCGCCTCCGACGCGATAGCCGAGGTCCCCGGA
TTCGAGGAGCAGATACCTTCGCTGCCACCGGAGGTGCAACGCCTCGACCGGTACGTGCAG
TTCGCGGTCGCGGCCGCACTGCAGGCCGTCCGTGACGCGGGGCTCCAGGACGGCGGCCAC
GACGCCGAGCGCACCGGGATCTCCCTGTCCACGGCGATCTGCGGCACGCCCAGGATGGAG
GAGGAGTTCCTCGCCGTCACCGACGAGGGCCGGAGGCCCATCGACCCGGCCAAGGCGGGC
CGCGACCTGTATCTCGCGGCCATGTCGAACACGCCCGGGACCGTCCTGTCGGCCCTGCTC
GGTGCCCAGGGCCCCTGCGTCACCCTCTCCACGGGCTGCATCGGCGGCATCGACGCGGTC
GGCCACGCCTACGAGTCGATCGCCCACGGCGACGCCGACGTCATGATCGCGGGTGCCAGC
GAGGCCCCCATCACCCCGGTGACCGTGGCCTCCTTCGAGATCATCAACTGCCTCTCCCGC
GCCCACCGGGGCCACCCCGAGGCCGCCTCGCGCCCCTACGACGCGGACCGCGACGGCTTC
GTCCTCGGCGAGGGCTGCGGCATCGTCGTCCTGGAGGAGAAGGAACACGCGCTGCGCCGC
GGCGCCACCCCCTACCTCCAGATCAGCGGCTTCTCGCACACGTCCAACGCCATCCACATG
ACCGACCTGCTGTCCGACGGCGAGGACCTGACCCGGGCGATGAGCCAGGCCATCGAGGTC
TCCGGGGTGGCGCCCGGCGCGATCGACCACGTCAGCTCGCACGGCAGCTCCACCCGGCAG
AACGACACCTGCGAGACCAGCGCCCTCAAGCTGGCGCTCGGCGAGCGCGCCCGGGAGATC
CCGGTGAACTCGGCGAAGTCCATGCTCGGCCATGCCCTGGCCGCCGCCAGCGCCATGGAG
ATCGTGCTGTGCGCCCTGGCCGGCCGGCACTCCTTCGTGCACCCCACGGCCAACTACGAG
ACGCCCGACCCCACCTGCGACCTCGACTACGTGCCGGGCACCGGCCGTCCCTGGGACGGC
GAGGTCATCCTCAAGGACGCCAGCGGCTTCGCGGGCCTGCACGCCGCGATGGTCGCCCGG
ACCGTCCGGGACGGGGGCCGGTCATGA
KS1..380
KS1..1140

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1-257]  2.99999999999998e-44 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [266-380]  9.20000000000002e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [1-269]  1.9e-53 G3DSA:3.40.47.10 [274-422]  3.5e-42 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-262]  2.69998997787809e-59 SSF53901 [224-422]  7.60000011115808e-54 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit