close all open/close all

CDS information : Resis_00070


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction5,352 / 6,590 / + [in whole cluster]
5,352 / 6,590 / + [in contig]
Location5352..6590 [in whole cluster]
5352..6590 [in contig]
TypeCDS
Length1,239 bp (412 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)RemB protein
Gene
Gene (GenBank)remB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)
Related Reference
ACC
Q54174
NITE
Urd_00130
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

CLF2..370

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [RemB protein]
MSIVITGIGAVTPAGDGVEPLWNSAREGTSHLATIDRFDAGDYACPVAGQADFDADAELP
SRFVKRTDRFTHLAVHTVRRALADAGVAVGTDVSPERTGVMVGNILGGWEFAERELRKLW
TDGPRAVSPYQATAWFPAAPQGNICIDQGIKGPARTFVADRASGAYALIGAAETLLRGRA
DVVLAGGVEAPLSPYGWLCLETSGLVAKARGSLAPHELYRPFDAGHGGSVFAEGSVFLVM
ERREHAERRGARVLGELAGWGVSTDGYMPYYTVEPTGRVLGRAMRTATERAGISDGDLGA
VFAHGSGIPFEDVTEGYGLWEAFGPGAARVPVTAPKSGFGHLLGAAAPADVALALRAMAA
GSVPPTVNLDRQAPGIELDIVRGAARPAPEWEHTLVVSRGLGGVNACLLLRR
selected fasta
>polyketide synthase chain length factor subunit [RemB protein]
ATGAGCATCGTCATCACCGGCATCGGTGCGGTCACCCCGGCGGGCGACGGCGTCGAACCC
CTGTGGAACAGCGCCCGCGAGGGCACCTCGCACCTCGCCACGATCGACCGCTTCGACGCC
GGGGACTACGCCTGCCCCGTCGCCGGCCAGGCCGACTTCGACGCCGACGCCGAGCTGCCC
TCCCGCTTCGTCAAGCGCACCGACCGCTTCACCCACCTCGCCGTGCACACCGTGCGCCGG
GCCCTGGCGGACGCCGGGGTCGCCGTCGGCACCGACGTCAGCCCGGAGCGCACCGGCGTC
ATGGTCGGCAACATCCTCGGCGGCTGGGAGTTCGCCGAGCGCGAGCTGCGCAAGCTGTGG
ACCGACGGCCCCCGCGCGGTCAGCCCGTACCAGGCCACCGCCTGGTTCCCGGCGGCCCCG
CAGGGCAACATCTGCATCGATCAGGGCATCAAGGGCCCGGCCCGCACGTTCGTCGCCGAC
CGGGCCAGCGGTGCCTACGCGCTGATCGGCGCCGCCGAGACCCTGCTGCGCGGCCGGGCG
GACGTCGTCCTCGCGGGTGGGGTGGAGGCCCCGCTGTCGCCGTACGGCTGGCTGTGCCTG
GAGACCAGCGGGCTGGTCGCCAAGGCCCGCGGCTCCCTCGCCCCGCACGAGCTGTACCGG
CCCTTCGACGCCGGGCACGGCGGCAGCGTCTTCGCCGAGGGCTCGGTGTTCCTGGTGATG
GAGCGCCGTGAGCACGCCGAGCGGCGCGGCGCCCGCGTCCTCGGCGAACTCGCCGGCTGG
GGCGTCAGCACCGACGGCTACATGCCGTACTACACGGTCGAGCCGACCGGCCGGGTGCTG
GGCCGGGCCATGCGCACCGCCACCGAGCGCGCCGGGATCTCCGACGGCGACCTGGGCGCG
GTCTTCGCACACGGCTCCGGCATCCCCTTCGAGGACGTCACCGAGGGCTACGGCCTCTGG
GAGGCGTTCGGGCCGGGTGCGGCCCGCGTGCCCGTCACCGCACCCAAGTCGGGCTTCGGG
CATCTGCTCGGCGCGGCCGCCCCGGCCGACGTGGCGCTCGCCCTGCGGGCCATGGCGGCG
GGCTCGGTGCCGCCCACCGTGAACCTCGACCGGCAGGCGCCGGGCATCGAGCTGGACATC
GTGCGGGGCGCGGCACGGCCGGCCCCGGAGTGGGAGCACACGCTGGTCGTGTCCCGAGGA
CTGGGAGGTGTCAACGCATGTCTGCTGCTGAGGCGTTGA
CLF2..370
CLF4..1110

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [2-245]  7.00000000000005e-45 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [254-370]  6.50000000000001e-23 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-259]  2.70000000000002e-55 G3DSA:3.40.47.10 [263-412]  1.09999999999999e-35 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-251]  3.10001307370206e-59 SSF53901 [213-412]  7.30000590915205e-48 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit