close all open/close all

CDS information : Resis_00080


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction6,569 / 6,997 / + [in whole cluster]
6,569 / 6,997 / + [in contig]
Location6569..6997 [in whole cluster]
6569..6997 [in contig]
TypeCDS
Length429 bp (142 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative holo-[acyl-carrier-protein] synthase
putative 4'-phosphopantetheinyl transferase AcpS
Product (GenBank)RemD protein
Gene
Gene (GenBank)remD
EC number2.7.8.7
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)
Related Reference
ACC
Q2MGB1
NITE
Fred_00280
PmId
[16895912] A dedicated phosphopantetheinyl transferase for the fredericamycin polyketide synthase from Streptomyces griseus. (J Biol Chem. , 2006)
Family/Domain
FD
IPR002582

close this sectionSequence

selected fasta
>putative holo-[acyl-carrier-protein] synthase [RemD protein]
MSAAEALIAEALLNAPATVRGVGIDVVDVQRLRAMLERRGRPLYDRLFTPAELVLCEGGS
PRHRANRLAGRIAAKEAVRKSLGAHGQGCGWLDVEIGRAESGQPLPRVSGRAEEAFRRAS
FTGLHLSITHEAGLALAIALAV
selected fasta
>putative holo-[acyl-carrier-protein] synthase [RemD protein]
ATGTCTGCTGCTGAGGCGTTGATCGCGGAAGCCCTGCTGAACGCCCCCGCGACGGTCCGC
GGGGTCGGCATCGACGTCGTGGACGTCCAGCGACTGCGGGCCATGCTCGAACGCCGTGGA
CGGCCGCTGTACGACCGGCTGTTCACGCCCGCCGAACTGGTCCTGTGCGAGGGCGGCTCG
CCGCGCCACCGGGCCAACCGCCTGGCCGGCCGGATCGCCGCCAAGGAGGCCGTCCGCAAG
TCCCTCGGCGCGCACGGACAGGGCTGCGGGTGGCTGGACGTCGAGATCGGCCGCGCCGAG
TCCGGGCAGCCGCTGCCGCGGGTGTCCGGGCGGGCCGAGGAGGCCTTCCGGCGGGCCTCG
TTCACCGGACTGCACCTGAGCATCACGCACGAGGCGGGGCTCGCCCTGGCGATCGCCCTC
GCCGTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002582 Holo-[acyl carrier protein] synthase (Family)
 [19-138]  5.20000000000001e-19 TIGR00516
TIGR00516   AcpS
IPR004568 Phosphopantethiene-protein transferase (Domain)
 [20-138]  1.4e-20 TIGR00556
TIGR00556   Pantethn_trn
 [25-104]  PD004282
PD004282   PPantethiene-prot_Trfase
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [18-141]  1.79999754022375e-22 SSF56214
SSF56214   4-PPT_transf
 [19-141]  7.29999999999999e-33 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [21-138]  7.4e-15 PF01648
PF01648   ACPS
SignalP
 [1-21]  0.865 Signal
Eukaryota   
TMHMM No significant hit