close all open/close all

CDS information : Resis_00090


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction7,042 / 7,293 / + [in whole cluster]
7,042 / 7,293 / + [in contig]
Location7042..7293 [in whole cluster]
7042..7293 [in contig]
TypeCDS
Length252 bp (83 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)RemC protein
Gene
Gene (GenBank)remC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)

close this sectionPKS/NRPS Module

ACP1..72

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [RemC protein]
MDVREQVFAVMRGVGFDGDELADGKRLAEDLDIDSTELVEIVVALEQHFDITVDADAEGG
FTTVGDLVGCVGRLLSAGSAARG
selected fasta
>polyketide synthase acyl carrier protein subunit [RemC protein]
ATGGACGTACGAGAGCAGGTGTTCGCCGTGATGCGCGGCGTCGGGTTCGACGGGGACGAA
CTGGCGGACGGCAAGCGGCTGGCCGAGGACCTCGACATCGACTCGACCGAGTTGGTGGAG
ATCGTCGTCGCCCTGGAGCAGCACTTCGACATCACCGTCGACGCGGACGCCGAGGGCGGC
TTCACCACCGTCGGCGACCTGGTGGGCTGTGTCGGACGGCTGCTGTCCGCCGGCAGCGCC
GCCAGGGGGTGA
ACP1..72
ACP1..216

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [18-70]  4.7e-07 PF00550
PF00550   PP-binding
 [1-72]  PS50075
PS50075   ACP_DOMAIN
 [14-77]  4.00000000000001e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [3-81]  6.69999687625999e-11 SSF47336
SSF47336   ACP_like
SignalP No significant hit
TMHMM No significant hit