close all open/close all

CDS information : Resis_00100


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction7,298 / 7,750 / + [in whole cluster]
7,298 / 7,750 / + [in contig]
Location7298..7750 [in whole cluster]
7298..7750 [in contig]
TypeCDS
Length453 bp (150 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)RemI protein
Gene
Gene (GenBank)remI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
[8692863] Deciphering the mechanism for the assembly of aromatic polyketides by a bacterial polyketide synthase. (Proc Natl Acad Sci U S A. , 1996)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[18388203] Crystal structure and functional analysis of tetracenomycin ARO/CYC: implications for cyclization specificity of aromatic polyketides. (Proc Natl Acad Sci U S A. , 2008)

close this sectionSequence

selected fasta
>putative cyclase [RemI protein]
MPRIENSIVIGADPRLVFDVTNDIARWSEIFDEYSHAKVLSEERDGRWTEIVFELTNEEG
AGWRSWRILDHRELVAVAERRDPLYPFAYMHLRWSYQEVPEGTLMTWIQDFELDDRFEVP
LATVLERMNTHTRHNQAGIKQKIESGAVRP
selected fasta
>putative cyclase [RemI protein]
ATGCCGCGGATCGAGAACAGCATCGTGATCGGGGCCGACCCCCGGCTTGTGTTCGACGTC
ACCAACGACATCGCCCGCTGGTCGGAGATCTTCGACGAGTACAGCCACGCCAAGGTCCTC
TCCGAGGAACGCGACGGCCGCTGGACGGAGATCGTGTTCGAGCTGACCAACGAGGAGGGG
GCCGGCTGGCGATCCTGGCGGATCCTGGACCACCGCGAGCTCGTGGCGGTCGCCGAACGC
CGCGATCCCCTCTACCCGTTCGCCTACATGCACCTGCGGTGGAGCTACCAGGAGGTTCCC
GAGGGGACGTTGATGACCTGGATCCAGGACTTCGAGCTCGACGACCGGTTCGAGGTCCCG
CTCGCGACGGTCCTGGAGCGGATGAACACGCACACCCGGCACAACCAGGCCGGCATCAAG
CAGAAGATCGAGTCGGGAGCCGTGCGGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [1-122]  6.80000000000001e-10 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [1-121]  3.2e-11 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit