close all open/close all

CDS information : Resis_00110


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction7,821 / 8,828 / + [in whole cluster]
7,821 / 8,828 / + [in contig]
Location7821..8828 [in whole cluster]
7821..8828 [in contig]
TypeCDS
Length1,008 bp (335 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative phosphotransferase
Product (GenBank)RemJ protein
Gene
Gene (GenBank)remJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
Family/Domain
FD
IPR011611, IPR002173

close this sectionSequence

selected fasta
>putative phosphotransferase [RemJ protein]
MRIAVTGSIAMDHLMSFPGRFAEQLVADRLHSVSLSFLSDRLEIRRGGVAANIAYGLGRL
GMSPVLVGAAGADFFDYQVWLGQHGVDTDSVLVVPGEHTARFVCTTDADHNQIATFHAGA
MRAAYTIALRDVRARVGELGLVVVSPNDPAAMLRHTEECRGAGLPFVADPSQQLARMDRA
DVRFLLSQARWLFTNEYEAALLQECTGWGAARVLDRVGTWVTTLGAGGVRLERAGHDPLV
VPAVPGVPVADPTGAGDALRAGMLAALALGVPAEPAARLGCALASFALESVGTQTYAPGD
RAVAGRVREVYGERALAELAPVPGLTAVTQKARLS
selected fasta
>putative phosphotransferase [RemJ protein]
GTGCGTATCGCCGTCACCGGGTCCATCGCCATGGACCACCTCATGTCCTTCCCCGGCCGG
TTCGCCGAGCAGCTCGTCGCCGACCGACTGCACAGCGTCTCCCTGTCGTTCCTGTCCGAC
CGGCTGGAGATACGACGTGGCGGCGTCGCCGCCAACATCGCCTACGGCCTCGGTCGGCTC
GGGATGTCCCCGGTGCTGGTCGGCGCGGCGGGGGCGGACTTCTTCGACTACCAGGTCTGG
CTGGGGCAGCACGGCGTCGACACCGACTCCGTTCTGGTCGTGCCGGGCGAGCACACGGCA
CGCTTCGTGTGCACCACCGACGCGGACCACAACCAGATCGCCACGTTCCACGCGGGCGCG
ATGCGGGCGGCGTACACCATCGCCCTGCGGGACGTCCGGGCCCGGGTCGGGGAGCTCGGC
CTGGTGGTCGTGTCGCCCAACGACCCCGCGGCGATGCTGCGGCACACCGAGGAGTGCCGC
GGCGCCGGGCTTCCGTTCGTCGCCGACCCCTCCCAGCAACTCGCCCGCATGGACCGGGCC
GACGTCCGGTTCCTGCTGAGTCAGGCCCGCTGGCTGTTCACCAACGAGTACGAGGCCGCG
CTGCTCCAGGAGTGCACGGGCTGGGGCGCGGCGCGCGTCCTGGACCGGGTTGGCACCTGG
GTGACCACGCTCGGCGCGGGCGGCGTACGCCTCGAGCGCGCCGGCCACGATCCGCTCGTC
GTTCCCGCGGTACCCGGAGTCCCGGTGGCCGATCCGACGGGTGCGGGGGACGCGCTGCGG
GCGGGCATGCTCGCCGCCCTCGCGCTCGGCGTACCGGCCGAGCCGGCGGCCCGCCTCGGC
TGCGCCCTCGCGTCCTTCGCCCTGGAGTCGGTCGGCACCCAGACCTACGCGCCCGGCGAC
CGGGCGGTGGCGGGCCGGGTGCGCGAGGTCTACGGCGAGCGGGCCCTGGCGGAACTGGCA
CCGGTGCCGGGCCTCACGGCCGTGACCCAGAAGGCGAGGCTGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002173 Carbohydrate/puine kinase, PfkB, conserved site (Conserved_site)
 [251-264]  PS00584
PS00584   PFKB_KINASES_2
 [47-71]  PS00583
PS00583   PFKB_KINASES_1
IPR011611 PfkB (Domain)
 [33-295]  3.89999999999997e-39 PF00294
PF00294   PfkB
SignalP
 [1-22]  0.146 Signal
Bacteria, Gram-negative   
 [1-27]  0.145 Signal
Eukaryota   
TMHMM No significant hit