close all open/close all

CDS information : Resis_00120


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction8,984 / 9,466 / + [in whole cluster]
8,984 / 9,466 / + [in contig]
Location8984..9466 [in whole cluster]
8984..9466 [in contig]
TypeCDS
Length483 bp (160 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)RemK protein
Gene
Gene (GenBank)remK
EC number
Keyword
Note
  • This ORF is not involved in resistomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [RemK protein]
MLGLWLPGPRPPLARWLSLPAGVVLVLLGAWMTADAVDRVYLRQPTPLGDRPPRYLVRSG
WYAVVRNPMAAGMTLVLAGETLLWSAPGIALWAAFVLAVSWTTGRRVEEPGLAATFGAEY
DAYRRAVPAWIPGTAAGPGRRGVRKQPRASLRRRPEPTEE
selected fasta
>hypothetical protein [RemK protein]
GTGCTGGGGCTGTGGCTGCCCGGCCCGCGACCGCCCCTGGCCCGCTGGCTGTCGCTGCCC
GCCGGAGTCGTCCTCGTCCTCCTCGGCGCGTGGATGACCGCGGACGCCGTGGACCGGGTC
TACCTGCGCCAGCCGACCCCGCTGGGCGACCGCCCGCCCCGGTATCTCGTGCGGTCCGGC
TGGTACGCGGTGGTCCGCAACCCCATGGCCGCCGGGATGACCCTCGTCCTGGCCGGCGAG
ACCCTGCTGTGGTCCGCGCCGGGCATCGCCCTGTGGGCGGCGTTCGTGCTGGCCGTGTCC
TGGACGACCGGCCGCCGGGTCGAGGAGCCGGGACTGGCAGCGACCTTCGGCGCCGAGTAC
GACGCCTACCGGCGTGCCGTGCCCGCGTGGATCCCCGGCACCGCGGCGGGCCCGGGGCGC
CGGGGCGTGCGGAAGCAGCCGAGAGCGAGCCTCCGGCGGCGGCCGGAACCGACCGAGGAG
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007318 Phospholipid methyltransferase (Family)
 [20-120]  1e-14 PF04191
PF04191   PEMT
SignalP
 [1-36]  0.674 Signal
Bacteria, Gram-positive   
 [1-36]  0.642 Signal
Bacteria, Gram-negative   
 [1-36]  0.985 Signal
Eukaryota   
TMHMM
 [12-34]  Transmembrane (i-o) [75-97]  Transmembrane (o-i)
Transmembrane 2