close all open/close all

CDS information : Resis_00130


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction9,469 / 10,299 / + [in whole cluster]
9,469 / 10,299 / + [in contig]
Location9469..10299 [in whole cluster]
9469..10299 [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)RemL protein
Gene
Gene (GenBank)remL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)
Related Reference
ACC
O68500
NITE
Adria_00160
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
ACC
Q9L4U2
NITE
Acla_00250
PmId
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
Q9RN54
NITE
Nogl_00250
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)

close this sectionSequence

selected fasta
>cyclase [RemL protein]
MFVDLSIPVSRRAPGVEFEQWLHRDGIRHLSRRIRALPGDSRRDRFVNHLRWLTGSRRLR
EQDLPDGCFMSNEFYRMSVHQGTHVDAPFHYGPECEGRPAKKVMDLPLEWFHGPGVVLDV
RGCGGRVTAADVKDALRAAGPEVGPGWVVLFRTDSDLRLGTPAYYTESTAITPEAVDLLL
DLGVKVLGTDCWSFDGPARRMVEDFFATGDSGALWPTHLHGRRREFVQIEGLARLRALPD
GPFTFMAFPVALADAGAAWCRAVARTGFQESGPAPR
selected fasta
>cyclase [RemL protein]
GTGTTCGTCGATCTGAGCATCCCCGTCAGCCGCCGCGCCCCCGGCGTCGAGTTCGAGCAG
TGGCTCCACCGGGACGGCATCCGCCATCTCTCCCGCCGCATCCGGGCGTTGCCGGGGGAC
AGCCGCCGGGACCGGTTCGTCAACCACCTGCGCTGGCTGACCGGCAGCCGCCGGCTGCGC
GAGCAGGACCTGCCCGACGGCTGCTTCATGTCCAACGAGTTCTACCGGATGTCCGTCCAC
CAGGGCACCCACGTCGACGCGCCCTTCCACTACGGCCCGGAGTGCGAGGGTCGCCCCGCG
AAGAAGGTCATGGACCTGCCCCTGGAGTGGTTCCACGGCCCCGGTGTCGTCCTCGACGTG
CGCGGCTGCGGGGGCCGGGTGACGGCCGCCGACGTCAAGGACGCGTTGCGCGCGGCCGGC
CCGGAGGTCGGCCCCGGCTGGGTGGTGCTGTTCCGCACCGACTCCGACCTGCGGCTCGGC
ACACCGGCGTACTACACCGAGTCCACGGCGATCACCCCCGAGGCCGTCGACCTGCTCCTG
GACCTCGGCGTGAAGGTGCTCGGCACGGACTGCTGGAGCTTCGACGGGCCGGCCCGCCGG
ATGGTCGAGGACTTCTTCGCGACGGGCGACTCCGGCGCCCTGTGGCCCACCCATCTGCAC
GGCAGGCGACGGGAGTTCGTCCAGATCGAGGGGCTGGCCCGGCTGCGGGCGCTGCCGGAC
GGCCCGTTCACGTTCATGGCGTTCCCCGTAGCCCTCGCCGACGCGGGGGCGGCCTGGTGC
CGGGCGGTGGCGCGTACCGGGTTCCAGGAGTCCGGTCCCGCCCCAAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [38-197]  3.29999999999997e-40 PF04199
PF04199   Cyclase
SignalP
 [1-36]  0.091 Signal
Eukaryota   
TMHMM No significant hit