close all open/close all

CDS information : Resis_00140


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction10,410 / 11,687 / + [in whole cluster]
10,410 / 11,687 / + [in contig]
Location10410..11687 [in whole cluster]
10410..11687 [in contig]
TypeCDS
Length1,278 bp (425 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpolyketide synthase acyl transferase domain protein
Product (GenBank)RemE protein
Gene
Gene (GenBank)remE
EC number
Keyword
Note
  • Similar to modular PKS AT domain
  • This ORF is not involved in resistomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)
Family/Domain
FD
IPR014043, IPR020801

close this sectionSequence

selected fasta
>polyketide synthase acyl transferase domain protein [RemE protein]
MAYDARTTHLLTLSADTSHALDEVARDTAARLARLGGASPAAWCAEAAGGPHSGQRMGVV
GRTAGEMADRIGAHLAGEPVREVSVGHADPARRPPVAFLFSGQGAQYAGMGRGLHRTEPV
FRAAFDRCAEAARPFTAVPLQDLLDPGAGPAVVHRLAHAALGTFCVNYALAELWRSWGVE
PAAVLGFSSGEYAATCWAGVLDPEDAVLLLGTQVTLAERVTDGAMAVVGLGEEAALELLA
ETGPSVGLAAVISPGEVSLSGRKAELARLVDRLTASGVRTSALPVSSGLHSPLQEPAADE
LRAVAAGIRTRPPRIPLVSTVTGAGVKGPPAPEHWVRHLSGPVRFLNAVRVLDELGVRAH
VEAGPGRALVGLGARCLPGEGRLWLASLGRSTDGTGPMLMALGRLHTAGVPVGWSGVYPG
SRSAV
selected fasta
>polyketide synthase acyl transferase domain protein [RemE protein]
ATGGCGTACGACGCCCGCACCACCCACCTCCTCACCCTCTCCGCCGACACCTCTCACGCC
CTCGACGAAGTCGCCCGCGACACCGCCGCCCGGCTCGCCCGGCTCGGCGGGGCCTCACCG
GCCGCGTGGTGCGCCGAGGCCGCCGGAGGGCCGCATTCCGGCCAACGGATGGGCGTGGTG
GGCCGCACGGCGGGTGAGATGGCCGACCGGATCGGCGCCCACCTGGCGGGCGAGCCGGTC
CGGGAGGTGTCCGTCGGGCACGCGGACCCGGCTCGCCGGCCGCCGGTCGCCTTCCTGTTC
AGCGGTCAGGGGGCGCAGTACGCCGGGATGGGCCGGGGTCTGCACCGCACCGAACCCGTC
TTCCGGGCCGCCTTCGACCGGTGCGCGGAGGCGGCCCGGCCGTTCACCGCCGTTCCCCTG
CAGGACCTGCTCGACCCCGGCGCGGGGCCGGCCGTGGTGCACCGCCTCGCCCACGCGGCC
CTCGGCACGTTCTGCGTGAACTACGCGCTGGCCGAGCTGTGGCGCAGCTGGGGGGTGGAA
CCCGCGGCGGTGCTCGGCTTCAGTTCGGGCGAGTACGCGGCCACCTGCTGGGCCGGGGTC
CTCGACCCGGAGGACGCGGTGCTGCTGCTGGGCACGCAGGTCACCCTGGCCGAGCGGGTC
ACGGACGGCGCGATGGCGGTGGTCGGCCTGGGGGAGGAGGCCGCGCTGGAACTCCTCGCG
GAGACCGGGCCGTCGGTCGGGCTCGCGGCGGTCATCTCCCCGGGCGAGGTGTCCCTGTCG
GGCCGGAAAGCGGAGCTCGCCCGACTGGTCGACCGCCTCACGGCCTCCGGTGTCCGTACC
AGCGCTCTGCCGGTGTCGTCGGGTCTGCACTCCCCGCTCCAGGAACCGGCGGCGGACGAA
CTGCGGGCCGTGGCCGCGGGGATCCGCACGCGTCCGCCCCGCATCCCCCTCGTGTCCACG
GTCACCGGCGCCGGGGTCAAGGGCCCGCCTGCCCCCGAGCACTGGGTCCGGCACCTGAGC
GGCCCGGTGCGGTTCCTAAACGCCGTCCGCGTCCTGGACGAACTCGGTGTCCGCGCCCAT
GTGGAGGCCGGGCCCGGCCGGGCGCTGGTCGGGCTCGGGGCCCGCTGTCTGCCGGGGGAG
GGGCGGCTGTGGCTGGCCTCGCTCGGCCGGAGCACGGACGGCACCGGGCCCATGCTCATG
GCGCTGGGGCGGTTGCACACGGCGGGTGTTCCGGTGGGCTGGAGCGGGGTTTACCCAGGG
TCCCGTTCCGCCGTATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [88-220]  1.80000000000002e-61 G3DSA:3.40.366.10 [287-399]  1.80000000000002e-61 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [98-378]  5.89999999999994e-51 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [95-395]  1.99999636034521e-56 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [221-286]  1.09999909120787e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [99-392]  6.69996745106047e-79 SM00827
SM00827   PKS_AT
SignalP
 [1-20]  0.162 Signal
Eukaryota   
 [1-20]  0.334 Signal
Bacteria, Gram-negative   
TMHMM No significant hit