close all open/close all

CDS information : Resis_00150


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction11,719 / 12,312 / + [in whole cluster]
11,719 / 12,312 / + [in contig]
Location11719..12312 [in whole cluster]
11719..12312 [in contig]
TypeCDS
Length594 bp (197 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)RemM protein
Gene
Gene (GenBank)remM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [RemM protein]
MVEQDIARSAPGRPRSAEVSRGINLAALALLRERGPQGVTVEAVAQYSGSAKTTIYRRYK
NRYELLRSSLAFVEDIPEPSPGLPVRERLVYLLTQFRHGLEEVVGLRALVALLHGDEDPE
FTQVFRETILGPRLEVIFQTLRSGVESGELRADADYETVVSMLAGSFIARFAVRGAPPPA
DWADAVVDTIWPAIRAA
selected fasta
>putative TetR family transcriptional regulator [RemM protein]
ATGGTTGAACAAGATATCGCCCGGTCCGCTCCGGGGCGCCCGCGCAGTGCCGAAGTGTCC
AGGGGAATCAATCTGGCCGCTCTCGCCCTGCTGCGGGAACGCGGCCCGCAGGGGGTCACG
GTCGAGGCGGTGGCCCAGTATTCGGGTTCCGCGAAGACCACCATCTACCGCCGGTACAAG
AACCGCTATGAACTTCTGAGGTCCTCGCTCGCTTTCGTCGAGGACATCCCCGAGCCGTCC
CCCGGCCTTCCGGTGCGGGAACGGCTGGTCTATTTGCTCACGCAATTCCGACATGGTCTG
GAAGAGGTCGTCGGCCTCCGGGCCCTGGTCGCCCTGCTGCACGGCGACGAGGACCCGGAG
TTCACCCAGGTGTTCCGCGAGACCATTCTGGGGCCGCGGCTGGAGGTCATCTTCCAGACG
CTCCGGTCCGGCGTGGAGAGCGGTGAGCTGAGGGCGGACGCCGACTACGAGACGGTGGTC
AGCATGCTGGCCGGTTCCTTCATCGCCCGGTTCGCCGTCCGGGGCGCGCCGCCGCCGGCA
GACTGGGCGGACGCGGTGGTCGACACCATCTGGCCGGCGATCCGGGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [17-77]  PS50977
PS50977   HTH_TETR_2
 [26-67]  5.6e-10 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [13-61]  4.3e-13 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [13-77]  1.29999924468179e-09 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [84-197]  5.20000089003336e-20 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [74-196]  4.5e-21 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit