close all open/close all

CDS information : Resis_00160


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction13,522 / 12,323 / - [in whole cluster]
13,522 / 12,323 / - [in contig]
Locationcomplement(12323..13522) [in whole cluster]
complement(12323..13522) [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productresistomycin hydroxylase
Product (GenBank)RemO protein
Gene
Gene (GenBank)remO
EC number
Keyword
  • resistoflavin
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[17090047] The boat-shaped polyketide resistoflavin results from re-facial central hydroxylation of the discoid metabolite resistomycin. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>resistomycin hydroxylase [RemO protein]
MKTETAQCVVVGGGPAGMMAGLLLARQGVEVTVVEKHGDFLRDFRGDTVHPSTLQVIDEL
GLLEEFLQIPHTKVTDITVSTAAGPTTFADFSKIRSRYPYIAFMPQWDVLDFLARKAGEL
PGFRLLQKTEGTTVIREGDRVCGVRADTPEGPLEIRSDLVIAADGRHSTMRKAVGLRVAA
SAAPMDVLWFRLEREPGETMTFLHTGQGFVLITIDRGAYWQVAYVIPQGQYDAVRAEGLG
RLRADVSSVHPPFAERVEREIRDWDDVKLLGVRVDRLRTWYRPGLLCVGDAAHAMSPAGG
VGINLAVQDAVAAARMLGPVLRTGRTPTPQELRRVQRRRELPVRAVQLAQVHMLADLYPK
DRGSVVERPFAARLVRRFPSLNRWTAQFIGVGLRPEHVS
selected fasta
>resistomycin hydroxylase [RemO protein]
ATGAAGACCGAGACCGCCCAGTGCGTCGTCGTCGGCGGCGGCCCCGCCGGGATGATGGCA
GGACTGCTGCTCGCCCGGCAGGGCGTGGAGGTCACCGTCGTCGAGAAGCACGGCGACTTC
CTGCGGGACTTCCGCGGCGACACCGTGCACCCCTCGACCCTCCAGGTCATCGACGAACTG
GGGCTGTTGGAGGAGTTCCTGCAGATCCCGCACACCAAGGTCACCGACATCACCGTGAGC
ACGGCCGCGGGGCCGACCACGTTCGCCGACTTCTCCAAGATCCGCAGCCGCTACCCGTAC
ATCGCGTTCATGCCGCAGTGGGACGTCCTGGACTTCCTGGCCCGCAAGGCCGGGGAACTG
CCCGGCTTCCGGCTGCTGCAGAAGACCGAGGGCACCACCGTGATCCGCGAGGGCGACCGG
GTGTGCGGAGTGCGCGCGGACACCCCGGAGGGGCCGCTGGAGATCCGGTCCGACCTGGTG
ATCGCCGCGGACGGCCGCCACTCGACCATGCGCAAGGCCGTAGGACTGCGGGTGGCGGCG
AGCGCGGCGCCCATGGACGTGCTGTGGTTCCGGCTCGAGCGCGAACCCGGCGAGACCATG
ACCTTCCTGCACACCGGACAGGGCTTCGTGCTGATCACCATCGACCGGGGCGCCTACTGG
CAGGTCGCGTACGTCATCCCGCAGGGCCAGTACGACGCCGTACGGGCGGAGGGCCTCGGC
CGCCTCAGGGCCGACGTGTCCTCGGTGCACCCGCCGTTCGCCGAGCGCGTCGAGCGGGAG
ATCCGGGACTGGGACGACGTGAAGCTCCTCGGCGTCCGGGTCGACCGGTTGCGCACCTGG
TATCGGCCCGGCCTGCTGTGCGTCGGAGACGCGGCGCACGCCATGTCCCCGGCCGGCGGA
GTCGGCATCAACCTCGCCGTGCAGGACGCGGTGGCGGCCGCGCGGATGCTCGGGCCGGTG
CTGCGCACCGGACGTACGCCGACCCCGCAGGAGCTGCGCCGGGTCCAGCGGCGGCGCGAA
CTGCCGGTACGGGCCGTGCAGTTGGCGCAGGTGCACATGCTGGCCGACCTGTATCCGAAG
GACCGCGGGTCGGTGGTGGAGCGGCCGTTCGCGGCCCGGCTGGTGCGGCGCTTCCCGTCC
CTGAACCGGTGGACGGCGCAGTTCATCGGTGTGGGGCTGCGTCCTGAGCACGTGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [7-322]  2.1e-51 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  1.60000240695997e-22 PR00420 [156-171]  1.60000240695997e-22 PR00420 [282-297]  1.60000240695997e-22 PR00420 [297-313]  1.60000240695997e-22 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-25]  0.141 Signal
Bacteria, Gram-negative   
TMHMM No significant hit