close all open/close all

CDS information : Resis_00170


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction15,108 / 13,561 / - [in whole cluster]
15,108 / 13,561 / - [in contig]
Locationcomplement(13561..15108) [in whole cluster]
complement(13561..15108) [in contig]
TypeCDS
Length1,548 bp (515 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)RemN protein
Gene
Gene (GenBank)remN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
Related Reference
ACC
Q9WVV3
PmId
[10198016] Mitomycin resistance in Streptomyces lavendulae includes a novel drug-binding-protein-dependent export system. (J Bacteriol. , 1999)
ACC
P42670
PmId
[7916693] The pur8 gene from the pur cluster of Streptomyces alboniger encodes a highly hydrophobic polypeptide which confers resistance to puromycin. (Eur J Biochem. , 1993)

close this sectionSequence

selected fasta
>putative drug resistance transporter [RemN protein]
MAPNRWWTLTVVSVGSFMLLLDVTIVNIALPDIEEALDATLTDLQWVVAAYAVALSAVLL
TAGSLADRFGRRAVFSWGMAVFTLASLLCGIAQDPLTLIAARVLQGVGGAALLATSLALL
AAAYPDHRDRHVALAVWGAVSGAALAVGPLAGGVLVEAAGWRWIFLVNLPVGVLALIATA
LRVAESRAESAGRIDWPGFLTFGTALGALSFALLRANEEGWGSAPVVSGFVLSAVSMTAF
VLVERARRDPMLPGALFRKITTTGAAIGVLAMSSTAFALLLYLTLYLQTVLGHEPLAAGL
RLLPLTLSIFVASAIAARVGTVLPARWLVSAGLACVGLGLLLMGDLSASDDWTALLAGQL
VTGLGVGLVNPNVVAAAMGAVEPARVGVASGLSNTCRSLGIAVGIAALGAVFADRVRDAV
HDALAGTPLQERAGELGHAVSSGQMGPALAGLPPEQRGIFTEAAHSAFVDGLNSILTVAA
VVAFVGALAVIPLIRSRDLSGTGPDGQPLPIAAGH
selected fasta
>putative drug resistance transporter [RemN protein]
ATGGCGCCCAACCGGTGGTGGACGCTGACCGTGGTGTCGGTGGGCAGCTTCATGCTGCTG
CTCGACGTCACGATCGTGAACATCGCGCTGCCCGACATCGAGGAGGCCCTGGACGCCACC
CTCACGGACCTGCAGTGGGTGGTTGCGGCCTACGCCGTGGCGCTGTCGGCCGTGCTGCTC
ACCGCGGGCTCCCTCGCCGACCGGTTCGGCCGACGGGCGGTCTTCTCCTGGGGCATGGCG
GTCTTCACGCTCGCCTCACTGCTGTGCGGCATCGCCCAGGACCCGCTCACTCTCATCGCG
GCCCGGGTGCTGCAGGGGGTGGGCGGCGCCGCCCTGCTCGCGACCTCGCTGGCACTGCTC
GCCGCCGCCTACCCCGACCACCGCGACCGGCATGTCGCCCTCGCGGTCTGGGGCGCCGTC
AGCGGGGCCGCGCTCGCCGTGGGACCGCTGGCCGGCGGGGTCCTGGTCGAGGCGGCCGGC
TGGCGGTGGATCTTCCTGGTCAACCTGCCCGTCGGGGTCCTCGCCCTGATCGCCACCGCG
CTGCGCGTCGCCGAGTCCCGGGCCGAGAGCGCCGGGCGGATCGACTGGCCCGGCTTCCTC
ACCTTCGGCACCGCGCTCGGCGCCCTGTCCTTCGCCCTGCTGCGGGCCAACGAGGAGGGC
TGGGGCAGCGCCCCGGTGGTCAGCGGCTTCGTCCTGTCGGCCGTGTCGATGACCGCGTTC
GTGCTGGTCGAGCGCGCCCGGCGCGACCCCATGCTCCCCGGCGCCCTGTTCCGCAAGATC
ACCACCACGGGTGCCGCCATCGGCGTCCTGGCCATGAGCTCCACGGCGTTCGCGCTGCTG
CTGTACCTGACGCTGTACCTGCAGACGGTCCTCGGGCACGAACCGCTGGCGGCCGGACTG
CGGCTGCTGCCGCTGACCCTCTCCATCTTCGTCGCCTCCGCGATCGCCGCCCGGGTGGGC
ACCGTGCTGCCGGCCCGCTGGCTGGTCTCCGCGGGCCTGGCCTGCGTCGGGCTCGGACTG
CTGCTGATGGGCGACCTCAGCGCGTCGGACGACTGGACCGCCCTGCTCGCCGGGCAGTTG
GTGACCGGGCTCGGCGTCGGACTGGTCAACCCGAACGTGGTCGCCGCCGCCATGGGCGCG
GTCGAACCGGCCCGGGTCGGGGTGGCCTCGGGGCTGAGCAACACCTGCCGCTCCCTGGGC
ATCGCCGTCGGCATCGCCGCCCTGGGCGCGGTCTTCGCCGACCGGGTGCGCGACGCGGTG
CACGACGCCCTCGCCGGCACCCCGCTCCAGGAGCGGGCGGGAGAGCTCGGCCACGCCGTC
TCCTCCGGACAGATGGGTCCCGCCCTCGCCGGACTCCCGCCCGAGCAGCGGGGGATCTTC
ACCGAGGCGGCGCACTCCGCGTTCGTCGACGGGCTGAACTCGATCCTGACGGTGGCGGCG
GTGGTGGCCTTCGTGGGCGCGCTCGCCGTCATCCCGCTCATTCGCAGCCGCGACCTCTCC
GGCACCGGGCCCGACGGCCAACCCCTGCCGATCGCCGCCGGGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [11-35]  5.59999989417023e-05 PR01036 [102-122]  5.59999989417023e-05 PR01036 [160-184]  5.59999989417023e-05 PR01036
PR01036   TCRTETB
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [9-489]  4.30000000000003e-80 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [13-404]  7.4e-53 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-497]  1.09999184471405e-70 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [8-498]  PS50850
PS50850   MFS
SignalP
 [1-29]  0.561 Signal
Eukaryota   
 [1-28]  0.424 Signal
Bacteria, Gram-positive   
TMHMM
 [7-29]  Transmembrane (i-o) [44-66]  Transmembrane (o-i) [73-92]  Transmembrane (i-o) [98-120]  Transmembrane (o-i) [133-155]  Transmembrane (i-o) [159-181]  Transmembrane (o-i) [194-216]  Transmembrane (i-o) [221-243]  Transmembrane (o-i) [264-286]  Transmembrane (i-o) [296-315]  Transmembrane (o-i) [322-344]  Transmembrane (i-o) [354-376]  Transmembrane (o-i) [472-494]  Transmembrane (i-o)
Transmembrane 13