close all open/close all
Resis_00170 Resis_00170   last last

CDS information : Resis_00180


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction15,873 / 15,208 / - [in whole cluster]
15,873 / 15,208 / - [in contig]
Locationcomplement(15208..15873) [in whole cluster]
complement(15208..15873) [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)RemP protein
Gene
Gene (GenBank)remP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
Related Reference
ACC
O32197
PmId
[15273097] Antibiotic-inducible promoter regulated by the cell envelope stress-sensing two-component system LiaRS of Bacillus subtilis. (Antimicrob Agents Chemother. , 2004)
Family/Domain
FD
IPR001789, IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [RemP protein]
MSSIRVLLVDSERLVAEGFQKLLEGFSEFSVVSVAPDGLSALKEVRRERPHLVVMGLCPA
GSDSAQVARAIRRDFQHVRIVVLATNQQPVYMREAFAAGANAYLSRNIGADELRDTLLTV
HREGAALSTVAAGQMLEMLSGRPTNGGSPLSLLTERERQILSLVADEQATHRIAKRLGIS
PKTVRNYLSRIYAKLGTQNRVQTALYAKRSLNRRPEPVAEL
selected fasta
>putative LuxR family transcriptional regulator [RemP protein]
ATGTCATCGATACGAGTCCTGCTCGTGGACAGCGAGCGGCTAGTGGCCGAAGGATTTCAG
AAGTTACTGGAGGGATTCTCCGAGTTCTCCGTCGTTTCCGTCGCCCCTGACGGGCTGTCG
GCCCTGAAGGAGGTACGCCGGGAGCGACCGCACCTGGTCGTCATGGGCCTGTGTCCGGCG
GGGTCCGACTCCGCGCAGGTCGCCCGGGCGATCCGCCGGGACTTCCAGCACGTACGGATC
GTCGTCCTCGCCACCAACCAGCAACCGGTCTACATGCGCGAGGCGTTCGCGGCGGGCGCC
AACGCCTATCTCTCCCGCAACATCGGCGCGGACGAGCTGCGCGACACCCTGCTCACCGTG
CACCGCGAGGGGGCCGCCCTCTCCACCGTGGCGGCGGGGCAGATGCTGGAGATGCTGTCG
GGGCGTCCGACCAACGGCGGCTCCCCCCTCTCCCTGCTCACCGAGCGCGAACGGCAGATC
CTGTCCCTCGTGGCCGACGAGCAGGCCACCCACCGCATCGCCAAGCGTCTGGGCATCAGC
CCGAAGACGGTCCGCAACTACCTCAGCCGCATCTACGCCAAGCTCGGCACCCAGAACCGC
GTACAGACCGCGCTGTACGCCAAGCGCTCCCTGAACCGCCGGCCGGAGCCGGTCGCGGAG
CTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [153-167]  1.9000006847787e-08 PR00038 [167-183]  1.9000006847787e-08 PR00038 [183-195]  1.9000006847787e-08 PR00038
PR00038   HTHLUXR
 [150-207]  4.19999771339581e-22 SM00421
SM00421   HTH_LUXR
 [146-211]  PS50043
PS50043   HTH_LUXR_2
 [152-207]  6.79999999999998e-18 PF00196
PF00196   GerE
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [5-121]  PS50110
PS50110   RESPONSE_REGULATORY
 [6-117]  4.10000000000001e-17 PF00072
PF00072   Response_reg
 [4-117]  1.49999977583352e-16 SM00448
SM00448   REC
IPR011006 CheY-like superfamily (Domain)
 [1-122]  2.90000354677981e-23 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [155-209]  3.5e-21 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [131-209]  5.39999384454126e-18 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
Resis_00170 Resis_00170   last last