close all open/close all
first first   Rever_00020 Rever_00020

CDS information : Rever_00010


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction909 / 1 / - [in whole cluster]
909 / 1 / - [in contig]
Locationcomplement(1..909) [in whole cluster]
complement(1..909) [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative amidohydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf-4
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative amidohydrolase]
MLVIDTHTHVISPDEDRYPTDPIGGHRSTWSQDHPVDLDGLLHALDDAGIDRAVVVQAST
VYGHDNRYLADSVAAHPDRLTGVYSLDATAPDAVDRINHWQSRGLNGFRLFTTGTTMPGQ
ADWLGHPDSYPAWEHAEKHDIPICLQMTIHGIPALRTTLDHYPRTRVLLDHCARPDLTDG
PPYHTSQALLDLAQYPGVHLKLTHRALDAATQGASTIPDFLTTLHTTYGPSRIMWGSNYP
AAQGPLTNLLTQARTHLTTLPETATTAILGGTANTFYFHTPATPATPTPATPATATPGAH
HA
selected fasta
>[putative amidohydrolase]
ATGCTGGTGATCGACACCCACACCCACGTCATCTCGCCCGACGAGGACCGCTACCCCACC
GACCCGATCGGCGGACACCGCTCCACCTGGTCACAAGACCACCCCGTCGACCTCGACGGA
CTCCTGCACGCCCTCGACGACGCCGGCATCGACCGCGCCGTCGTCGTCCAAGCCTCCACC
GTCTACGGACACGACAACCGCTACCTCGCCGACTCCGTCGCCGCCCACCCCGACCGCCTC
ACCGGCGTCTACTCCCTCGACGCCACCGCACCCGACGCCGTCGACCGCATCAACCACTGG
CAATCCCGCGGCCTCAACGGCTTCCGCCTGTTCACCACCGGCACCACCATGCCCGGACAA
GCCGACTGGCTCGGCCACCCCGACAGCTACCCCGCCTGGGAACACGCCGAAAAACACGAC
ATCCCCATCTGCCTCCAGATGACCATCCACGGCATCCCCGCCCTACGCACCACCCTCGAC
CACTACCCCCGCACCCGCGTCCTCCTCGACCACTGCGCCCGCCCCGACCTCACCGACGGA
CCCCCCTACCACACCTCCCAAGCCCTCCTCGACCTCGCCCAATACCCCGGCGTCCACCTC
AAACTCACCCACCGCGCCCTCGACGCCGCCACCCAAGGCGCCTCCACCATCCCCGACTTC
CTCACCACCCTCCACACCACCTACGGACCCTCCCGCATCATGTGGGGATCCAACTACCCC
GCCGCCCAAGGCCCCCTCACCAACCTCCTCACCCAAGCCCGCACCCACCTCACCACCCTC
CCCGAAACCGCCACCACCGCCATCCTCGGCGGCACCGCCAACACCTTCTACTTCCACACC
CCCGCAACCCCCGCAACCCCCACCCCGGCAACCCCCGCAACCGCCACCCCCGGGGCCCAC
CATGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006992 Amidohydrolase 2 (Family)
 [4-277]  8.49999999999995e-32 PF04909
PF04909   Amidohydro_2
SignalP No significant hit
TMHMM No significant hit
first first   Rever_00020 Rever_00020