close all open/close all

CDS information : Rever_00020


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction1,637 / 954 / - [in whole cluster]
1,637 / 954 / - [in contig]
Locationcomplement(954..1637) [in whole cluster]
complement(954..1637) [in contig]
TypeCDS
Length684 bp (227 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf-3
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[hypothetical protein]
MHELGVVHTTIERADPDAVARLSALGVATVHEAMGRLGLMRPSIRPVYSGARLCGTAVTV
LLQPGDNWMLHVAAEQIRPGDVVVAACTSESHDGFFGELLATSYRARGARGLVIDGGCRD
VADLERMDFPVFSAAIHAKGTVKATPGSVNVPVVCAGALVTPGDVVLADADGVVVVPAAK
AAATADAGEAREANEETKRRRLAAGELGLDIYQMRDELRARGLRYTD
selected fasta
>[hypothetical protein]
ATGCACGAACTCGGCGTCGTCCACACGACGATCGAGCGGGCCGATCCCGACGCAGTGGCG
CGGCTGTCCGCGCTGGGCGTGGCGACCGTGCACGAGGCGATGGGCCGGCTCGGCCTGATG
CGCCCCTCCATCCGGCCGGTCTACTCCGGCGCCCGCCTGTGCGGCACCGCGGTGACGGTG
CTGCTCCAGCCCGGCGACAACTGGATGCTGCACGTCGCCGCCGAACAGATCCGGCCGGGT
GACGTGGTGGTCGCGGCCTGCACGTCCGAGAGCCACGACGGCTTCTTCGGCGAGCTGCTG
GCCACCTCCTACCGGGCGCGCGGCGCCCGCGGCCTGGTGATCGACGGCGGCTGCCGCGAC
GTCGCCGACCTGGAGCGGATGGACTTCCCCGTCTTCAGCGCGGCGATCCACGCCAAGGGC
ACGGTCAAGGCCACCCCCGGCTCGGTCAACGTGCCGGTCGTCTGCGCGGGGGCGCTGGTC
ACCCCCGGCGACGTGGTGCTCGCGGACGCGGACGGCGTGGTCGTCGTACCCGCCGCCAAG
GCGGCCGCGACGGCCGACGCCGGGGAGGCCCGCGAGGCCAACGAGGAGACCAAGCGCCGG
CGGCTCGCGGCCGGCGAACTCGGCCTGGACATCTACCAGATGCGCGACGAGCTGCGGGCG
CGCGGCCTGCGCTACACCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005493 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (Domain)
 [29-175]  1e-31 PF03737
PF03737   Methyltransf_6
 [21-176]  5.09998762524166e-50 SSF89562
SSF89562   RNaseE_inh/diMeMenaQ_MeTrfase
 [25-182]  1.6e-58 G3DSA:3.50.30.40
G3DSA:3.50.30.40   RNaseE_inh/diMeMenaQ_MeTrfase
IPR014165 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (Family)
 [5-225]  5.50000000000008e-115 TIGR02798
TIGR02798   LigK_PcmE
SignalP No significant hit
TMHMM No significant hit