close all open/close all

CDS information : Rever_00030


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction2,899 / 1,874 / - [in whole cluster]
2,899 / 1,874 / - [in contig]
Locationcomplement(1874..2899) [in whole cluster]
complement(1874..2899) [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative amidohydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf-2
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative amidohydrolase]
MIIDCHGHYTTAPAALGDWRDRQVRALAGDGEPPRPADLRIGDDEIRETIEANQLRQMDE
RGIDLTVFSPRASFMAHHVGDFAVSEAWARCCNDLCARVGELFPDRFAPAAMLPQSPGVD
PATCVPELVRAVEELGAVAVNLNPDPSGGHWSAPPLTDRSWYPLYEKIVELDVPVMVHVS
TSANPAFHTTGAHYLNADTTAFMQLLQGDLFADFPTLRMVIPHGGGTVPYHWGRFRGLAQ
ALGRPEPAEHVLGNVYFDTCVYHQPGIDLLLKVIPHANVLFASEMIGAVRGIDPDTGHHF
DDTRRYVEQAGLSAADLAAITEGNARAVYPRLDARLRASGR
selected fasta
>[putative amidohydrolase]
TTGATCATCGACTGCCACGGCCACTACACGACCGCACCCGCGGCTCTGGGCGACTGGCGC
GACCGCCAGGTCCGGGCCCTGGCCGGCGACGGCGAACCGCCGCGACCCGCCGACCTGCGG
ATCGGCGACGACGAGATCCGCGAGACCATCGAGGCCAACCAGCTCCGGCAGATGGACGAG
CGCGGCATCGACCTGACGGTCTTCTCCCCGCGCGCGTCGTTCATGGCCCACCACGTCGGC
GACTTCGCCGTGTCGGAGGCGTGGGCACGGTGCTGCAACGACCTGTGCGCCCGGGTCGGC
GAGCTGTTCCCCGACCGGTTCGCGCCGGCCGCGATGCTGCCGCAGTCGCCCGGGGTCGAT
CCGGCGACCTGCGTGCCGGAGCTGGTCCGCGCGGTCGAGGAGCTCGGCGCCGTGGCGGTC
AACCTCAACCCGGACCCCTCCGGCGGCCACTGGAGCGCCCCGCCGCTGACCGACCGCTCC
TGGTACCCGCTGTACGAGAAGATCGTCGAACTCGACGTCCCCGTGATGGTGCACGTGAGC
ACCAGTGCGAACCCCGCGTTCCACACCACCGGCGCGCACTACCTCAACGCCGACACCACC
GCCTTCATGCAGTTGCTCCAGGGCGACCTGTTCGCCGACTTCCCCACCCTGCGGATGGTC
ATCCCGCACGGCGGCGGCACCGTCCCCTATCACTGGGGGCGCTTCCGCGGCCTCGCCCAG
GCGCTCGGCAGGCCGGAGCCGGCCGAACACGTGCTGGGCAACGTCTACTTCGACACCTGC
GTCTACCACCAGCCCGGGATCGACCTGCTGTTGAAGGTGATCCCGCACGCCAACGTGCTC
TTCGCCTCGGAGATGATCGGCGCGGTGCGCGGCATCGACCCCGACACCGGGCACCACTTC
GACGACACCCGCCGCTACGTCGAGCAGGCGGGCCTGTCCGCCGCGGACCTCGCGGCGATC
ACCGAGGGCAACGCCCGCGCCGTCTACCCCCGGCTCGACGCGCGCCTGCGGGCGTCCGGC
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006992 Amidohydrolase 2 (Family)
 [3-331]  3.80000000000003e-45 PF04909
PF04909   Amidohydro_2
SignalP No significant hit
TMHMM No significant hit