close all open/close all

CDS information : Rever_00040


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction3,134 / 3,793 / + [in whole cluster]
3,134 / 3,793 / + [in contig]
Location3134..3793 [in whole cluster]
3134..3793 [in contig]
TypeCDS
Length660 bp (219 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf-1
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative transcriptional regulator]
MKGVAARLHVGARIRHALWVGEIVPGQRLVEQDLADRLEVTRSSVREALLDLASDDLVEL
VPNRGARIRVVSVEEAVQITECRSALERLCARKAAERVTPEQRAALAEVGEQLRTAVAEG
ALEAYSTLNRRLHDLIIEFSGQAVARRQLERLNTQMVRFQFRLAMRPGRPQESLPQLLAI
VDAVGSGDPDAADKAAEAQLAGVIAQLRASDPPAALSGW
selected fasta
>[putative transcriptional regulator]
ATGAAGGGAGTCGCCGCGCGGCTCCACGTCGGCGCCCGGATCCGCCACGCCCTGTGGGTC
GGCGAGATCGTCCCCGGGCAGCGGCTGGTGGAACAGGACCTGGCCGACCGGCTGGAGGTC
ACCCGCAGCTCCGTCCGCGAGGCGCTGCTCGACCTCGCCTCGGACGACCTGGTGGAGCTG
GTGCCCAACCGCGGCGCCCGGATCAGGGTGGTCTCGGTCGAGGAGGCCGTCCAGATCACC
GAGTGCCGCTCCGCGCTGGAGCGGCTGTGCGCGCGCAAGGCGGCCGAGCGCGTCACCCCG
GAGCAGCGCGCCGCGCTGGCCGAGGTCGGCGAGCAACTGCGCACGGCGGTCGCGGAAGGA
GCGCTGGAGGCGTACTCCACCCTCAACCGCAGGCTGCACGACCTGATCATCGAGTTCAGC
GGCCAGGCCGTCGCCCGGCGCCAGCTCGAACGGCTCAACACGCAGATGGTGCGCTTCCAG
TTCCGGCTGGCCATGCGGCCCGGCCGGCCTCAGGAGTCGCTGCCGCAACTGCTGGCCATC
GTGGACGCCGTCGGCTCCGGCGACCCCGACGCCGCCGACAAGGCCGCCGAGGCGCAGCTG
GCCGGCGTCATCGCGCAGTTGCGGGCGAGCGATCCCCCGGCCGCCCTGAGCGGATGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000524 Transcription regulator HTH, GntR (Domain)
 [4-71]  PS50949
PS50949   HTH_GNTR
 [9-68]  9.5e-16 PF00392
PF00392   GntR
 [10-68]  2.89999717862184e-15 SM00345
SM00345   HTH_GNTR
IPR011711 GntR, C-terminal (Domain)
 [78-202]  1.39999892049878e-21 SM00895
SM00895   FCD
 [78-201]  7.20000000000003e-27 PF07729
PF07729   FCD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [8-69]  3.3e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit