close all open/close all

CDS information : Rever_00050


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction4,375 / 5,676 / + [in whole cluster]
4,375 / 5,676 / + [in contig]
Location4375..5676 [in whole cluster]
4375..5676 [in contig]
TypeCDS
Length1,302 bp (433 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative C4-dicarboxylate transport protein
Product (GenBank)putative transporter
GenerevO
dctA
Gene (GenBank)revO
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
P0A830
PmId
[10482502] Inactivation and regulation of the aerobic C(4)-dicarboxylate transport (dctA) gene of Escherichia coli. (J Bacteriol. , 1999)
ACC
P20672
PmId
[2793824] Conservation between coding and regulatory elements of Rhizobium meliloti and Rhizobium leguminosarum dct genes. (J Bacteriol. , 1989)
[2551890] Identification and sequence analysis of the Rhizobium meliloti dctA gene encoding the C4-dicarboxylate carrier. (J Bacteriol. , 1989)
[2134335] Analysis of the C4-dicarboxylate transport genes of Rhizobium meliloti: nucleotide sequence and deduced products of dctA, dctB, and dctD. (Mol Plant Microbe Interact. , 1990)
[8232193] The membrane topology of the Rhizobium meliloti C4-dicarboxylate permease (DctA) as derived from protein fusions with Escherichia coli K12 alkaline phosphatase (PhoA) and beta-galactosidase (LacZ). (Mol Gen Genet. , 1993)

close this sectionSequence

selected fasta
>putative C4-dicarboxylate transport protein [putative transporter]
MSETVTIDAPPAAPKPPTPFYRDLAVQVLAGVALGVLVGNYAPSVGRHTQFLGDIFIHLI
QMVVGLIIFCTVTHGIASVRDLGKVGRIAVRALVYFEVITTAALIIGLVVVNVLHPGSGV
HIDLSHNGGAGTAPAKSEGFDDFLVGLVPTSAVQAFAQGDILQVLVFSVLFACGLASLGE
RSAPVLELVGTVQKTLFWIIGKVMRIAPLAAFGAIGYTVSKYGLGTLTSLGKLIGVFYLI
VLLFFLLVLWPVSRYAGVSLLKVLRYFRAELLLVLGTSSSESVFPQLTSKLERLGVEQSV
VGLVLPTAYSFNHDGTCLYFASVSVFLAQATGTDLGWQAQIGLLLILLLTSKGGAGVSGS
AIAVLALTLSSTHKIPVDSIALVLGIHSILSAAFVFTNIAGNCVATLVVGKWENAIDRVR
LHKELDAGFTTAA
selected fasta
>putative C4-dicarboxylate transport protein [putative transporter]
ATGAGCGAGACCGTCACGATAGACGCGCCGCCCGCGGCGCCCAAACCCCCTACCCCGTTC
TACCGGGACCTGGCCGTCCAGGTCCTCGCAGGCGTCGCGCTGGGCGTCCTGGTGGGCAAC
TACGCCCCCTCTGTCGGGCGGCACACGCAGTTCCTCGGCGACATCTTCATCCACCTGATC
CAGATGGTCGTCGGGCTGATCATCTTCTGCACGGTGACCCACGGCATCGCGAGCGTGCGG
GACCTGGGGAAGGTCGGCCGGATCGCGGTCCGGGCGCTGGTGTACTTCGAGGTGATCACC
ACCGCGGCCCTGATCATCGGGCTGGTCGTGGTCAACGTGCTGCACCCGGGCTCGGGAGTG
CACATCGACCTGTCGCACAACGGCGGGGCCGGCACCGCGCCGGCCAAGTCCGAGGGCTTC
GACGACTTCCTGGTCGGCCTGGTCCCCACCTCGGCGGTGCAGGCGTTCGCCCAGGGCGAC
ATCCTCCAGGTGCTGGTGTTCTCGGTGCTGTTCGCCTGCGGACTGGCCTCGCTGGGCGAG
CGGAGCGCGCCGGTGCTGGAACTGGTCGGCACCGTCCAGAAGACGCTGTTCTGGATCATC
GGCAAGGTGATGCGGATCGCGCCCCTGGCGGCCTTCGGCGCCATCGGCTACACCGTCTCC
AAGTACGGCCTGGGCACGCTCACTTCGCTGGGCAAGCTGATCGGCGTCTTCTACCTGATC
GTGCTCCTCTTCTTCCTCCTCGTCCTGTGGCCGGTCTCCCGGTACGCCGGGGTCAGCCTG
CTGAAGGTGCTGCGCTACTTCCGCGCGGAACTGCTGCTGGTGCTGGGCACCAGCTCGTCG
GAGAGCGTCTTCCCGCAGCTCACGTCGAAGCTGGAGCGGCTGGGCGTCGAGCAGTCGGTG
GTCGGCCTGGTGCTGCCGACCGCGTACAGCTTCAACCACGACGGCACGTGCCTGTACTTC
GCCTCGGTGAGCGTCTTCCTCGCCCAGGCCACCGGTACCGACCTGGGCTGGCAGGCGCAG
ATCGGCCTGCTGCTCATCCTGCTGCTCACGTCCAAGGGCGGGGCGGGGGTCTCCGGCTCG
GCGATCGCCGTGCTGGCGCTGACGCTCAGCTCCACGCACAAGATCCCCGTGGACAGCATC
GCGCTGGTGCTGGGCATCCACAGCATCCTGTCGGCCGCGTTCGTGTTCACCAACATCGCG
GGGAACTGCGTGGCCACGCTGGTGGTCGGCAAGTGGGAGAACGCCATCGACCGGGTCCGG
CTGCACAAGGAACTCGACGCCGGGTTCACGACCGCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001991 Sodium:dicarboxylate symporter (Family)
 [18-38]  3.89999861795218e-26 PR00173 [59-79]  3.89999861795218e-26 PR00173 [89-114]  3.89999861795218e-26 PR00173 [156-178]  3.89999861795218e-26 PR00173 [229-248]  3.89999861795218e-26 PR00173 [303-329]  3.89999861795218e-26 PR00173 [366-386]  3.89999861795218e-26 PR00173
PR00173   EDTRNSPORT
 [24-412]  2.70000000000002e-94 PF00375
PF00375   SDF
SignalP
 [1-35]  0.237 Signal
Eukaryota   
TMHMM
 [20-42]  Transmembrane (i-o) [57-79]  Transmembrane (o-i) [92-114]  Transmembrane (i-o) [161-183]  Transmembrane (o-i) [196-218]  Transmembrane (i-o) [233-252]  Transmembrane (o-i) [343-365]  Transmembrane (i-o) [380-402]  Transmembrane (o-i)
Transmembrane 8