close all open/close all

CDS information : Rever_00060


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction6,399 / 5,725 / - [in whole cluster]
6,399 / 5,725 / - [in contig]
Locationcomplement(5725..6399) [in whole cluster]
complement(5725..6399) [in contig]
TypeCDS
Length675 bp (224 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative GntR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)revP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
Q84II9
PmId
[15277751] Divergent structures of carbazole degradative car operons isolated from gram-negative bacteria. (Biosci Biotechnol Biochem. , 2004)
[16455652] Differentiation of carbazole catabolic operons by replacement of the regulated promoter via transposition of an insertion sequence. (J Biol Chem. , 2006)

close this sectionSequence

selected fasta
>putative GntR family transcriptional regulator [putative transcriptional regulator]
MAQDRKSGRAGRSAVQQGVRQALAAGDMVPGQRLVEQELSDGFGVTRSSVREALQELAAE
GLVELVPNRGARVRVVSIEDAVLITECRSALEVLCARRAAVHATDDDRQALGGIGEGMRA
AVAEGALDTYSALNRRLHERVAAASGQTVAESLLDRLNAQMVRHQFRLAARAGRPAQSLP
QHLAIIDAIVAGDPDAAEKATRAHLDSVLEQVRATAGGAPSLVP
selected fasta
>putative GntR family transcriptional regulator [putative transcriptional regulator]
GTGGCGCAGGACCGGAAGTCGGGGCGGGCGGGGCGGAGCGCGGTGCAGCAGGGCGTCCGC
CAGGCGCTCGCGGCCGGGGACATGGTTCCCGGCCAGCGGCTGGTGGAGCAGGAGTTGTCG
GACGGCTTCGGCGTCACCCGCAGTTCGGTCCGCGAGGCCCTCCAGGAACTGGCCGCCGAG
GGGCTGGTGGAACTGGTCCCGAACCGGGGCGCGCGGGTCCGCGTGGTCTCGATCGAGGAC
GCCGTGCTGATCACGGAGTGCCGCTCCGCCCTCGAAGTCCTGTGTGCGCGGCGGGCGGCC
GTCCACGCGACGGACGACGACCGGCAGGCGCTCGGCGGGATCGGGGAGGGCATGCGCGCG
GCCGTCGCGGAAGGCGCCCTGGACACCTACTCCGCCCTCAATCGCCGCCTGCACGAGCGG
GTGGCCGCCGCGAGCGGCCAGACGGTGGCCGAGTCGCTGCTCGACCGGCTCAACGCCCAG
ATGGTGCGCCACCAGTTCCGGTTGGCCGCCCGCGCGGGCCGGCCCGCCCAGTCGCTCCCC
CAGCACCTGGCGATCATCGACGCGATCGTGGCCGGGGACCCGGACGCCGCCGAGAAGGCG
ACGCGGGCACACCTCGACAGCGTCCTGGAACAGGTGCGCGCCACCGCCGGCGGCGCCCCC
TCCCTCGTCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000524 Transcription regulator HTH, GntR (Domain)
 [33-47]  8.70000305989074e-07 PR00035 [47-63]  8.70000305989074e-07 PR00035
PR00035   HTHGNTR
 [14-73]  1.2e-16 PF00392
PF00392   GntR
 [15-73]  1.69999922284049e-15 SM00345
SM00345   HTH_GNTR
 [9-76]  PS50949
PS50949   HTH_GNTR
IPR011711 GntR, C-terminal (Domain)
 [83-207]  6.09999977126211e-22 SM00895
SM00895   FCD
 [84-206]  2.5e-26 PF07729
PF07729   FCD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [3-74]  7.5e-20 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-24]  0.208 Signal
Bacteria, Gram-negative   
TMHMM No significant hit