close all open/close all

CDS information : Rever_00070


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction7,424 / 6,591 / - [in whole cluster]
7,424 / 6,591 / - [in contig]
Locationcomplement(6591..7424) [in whole cluster]
complement(6591..7424) [in contig]
TypeCDS
Length834 bp (277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)revQ
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
Q83X29
PmId
[12791134] The large linear plasmid pSLA2-L of Streptomyces rochei has an unusually condensed gene organization for secondary metabolism. (Mol Microbiol. , 2003)
[20378964] Regulation of lankamycin biosynthesis in Streptomyces rochei by two SARP genes, srrY and srrZ. (Biosci Biotechnol Biochem. , 2010)
ACC
Q9XCC4
PmId
[11985721] Differential roles of two SARP-encoding regulatory genes during tylosin biosynthesis. (Mol Microbiol. , 2002)
[16942604] Regulation of tylosin biosynthesis involving 'SARP-helper' activity. (Mol Microbiol. , 2006)
ACC
P25047
NITE
Adria_00210
PmId
[1729206] Regulation of secondary metabolism in Streptomyces spp. and overproduction of daunorubicin in Streptomyces peucetius. (J Bacteriol. , 1992)
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[8971703] Purification and characterization of the DNA-binding protein DnrI, a transcriptional factor of daunorubicin biosynthesis in Streptomyces peucetius. (Mol Microbiol. , 1996)
[16545946] Feedback regulation of doxorubicin biosynthesis in Streptomyces peucetius. (Res Microbiol. , 2006)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative transcriptional regulator]
MDIGILGPLVVGASDRDAAPSAPKPRQLLALLAVRAGRVVPVDLLVEELWESSPPPSALT
TVQTYIVLLRRLLAKCLRVSSAAVAQEVLTYTGWGYQLSADEGTHDATDFARHAALGRRA
LAEGDNGRASAALREALARWRGPALVDVRTGPHLLAHQVSLEEQRMGTVEQRIEADLRLG
RHHEVIGELSGLVVQHPLHENIHSLLMVALYRSGRPGQALATFQQLHQNLRDELGMEPSP
RIRTVQQGILRRDSSLEAVEESKLFLQQLTAPSRPAG
selected fasta
>putative transcriptional regulator [putative transcriptional regulator]
TTGGACATCGGGATTCTCGGGCCCCTGGTCGTCGGCGCCAGCGACCGGGACGCGGCACCG
AGCGCACCAAAGCCCCGGCAATTACTGGCGTTACTCGCGGTTCGGGCCGGCCGCGTCGTC
CCCGTCGACCTGCTGGTCGAGGAACTGTGGGAAAGCTCTCCCCCGCCGAGCGCGCTCACC
ACGGTGCAGACCTACATCGTGCTGCTGCGGCGGCTGCTGGCGAAATGCCTCCGGGTGAGC
AGCGCCGCGGTGGCCCAGGAGGTGCTAACGTACACCGGCTGGGGATACCAGTTGTCGGCG
GACGAAGGCACCCACGACGCCACGGACTTCGCCCGGCACGCCGCTCTCGGGCGCCGTGCA
CTGGCCGAAGGCGACAACGGCCGGGCCTCGGCGGCGTTGCGCGAGGCACTCGCCCGCTGG
CGCGGACCGGCACTGGTGGACGTGCGCACCGGCCCGCACCTGCTGGCCCATCAGGTGTCG
CTCGAGGAACAGCGCATGGGCACCGTGGAGCAGCGTATTGAGGCCGATCTGCGGCTGGGG
CGCCATCACGAAGTGATAGGCGAACTGTCCGGCCTCGTGGTGCAGCACCCGCTGCACGAG
AATATCCACTCGCTATTGATGGTCGCGCTGTACCGGTCGGGCCGGCCGGGGCAGGCGCTG
GCGACTTTCCAGCAGCTTCACCAGAACCTGCGCGACGAATTGGGAATGGAGCCGTCGCCG
CGTATCCGGACGGTCCAGCAGGGAATTCTGCGCCGGGACTCGTCGTTGGAGGCCGTCGAG
GAGTCCAAGCTGTTCCTCCAGCAACTGACGGCCCCCTCGCGGCCGGCGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [19-98]  1.5e-15 PF00486
PF00486   Trans_reg_C
 [17-98]  1.59999889349252e-11 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [106-250]  5.69999999999998e-49 PF03704
PF03704   BTAD
 [105-250]  1e-49 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [109-227]  4.69999999999999e-06 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-101]  1.3e-09 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-99]  1.80000149287196e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-36]  0.107 Signal
Bacteria, Gram-negative   
TMHMM No significant hit