close all open/close all

CDS information : Rever_00080


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction8,942 / 7,941 / - [in whole cluster]
8,942 / 7,941 / - [in contig]
Locationcomplement(7941..8942) [in whole cluster]
complement(7941..8942) [in contig]
TypeCDS
Length1,002 bp (333 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative beta-ketoacyl synthase
Product (GenBank)putative 3-oxoacyl-ACP synthase
Gene
Gene (GenBank)revR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
B1GSM6
NITE
Bena_00160
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
[19047004] Ketosynthase III as a gateway to engineering the biosynthesis of antitumoral benastatin derivatives. (J Biotechnol. , 2009)
ACC
Q9F6D4
NITE
R1128_00080
PmId
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionSequence

selected fasta
>putative beta-ketoacyl synthase [putative 3-oxoacyl-ACP synthase]
MAGTIGTAAGAAGSRILGVGAYRPGRVVPNDELVELIDSSDEWIRRHSGIVSRRFGDAEE
TVVGMAVAASLKALAQAGVAAEEVDMVLLATMSHLEQSPAAAPQIAHLTGASSAGAMDVS
AACAGFVHALAVADALIRTGAARRVLVVGSEKMTDIIDLRDRATAFLFGDGAGAVVVGPA
DTPGIGPVVWGSDGGHREAIAHSGSWLELRDGQAAWPTLRMNGPSVYRWAIGTVPQVCRR
ALAAAGTDPAELGAFIPHQANLRIVDAAVAALGLPPHVAVSRDVTDTGNTSAASIPLAME
RMVAQGRAGSGDLALLVGFGAGLTHAAMVVALP
selected fasta
>putative beta-ketoacyl synthase [putative 3-oxoacyl-ACP synthase]
ATGGCGGGCACGATCGGCACGGCCGCCGGGGCCGCCGGCTCGCGCATCCTGGGCGTCGGC
GCGTACCGGCCCGGCCGGGTGGTGCCGAACGACGAACTCGTGGAGCTGATCGACTCCAGC
GACGAGTGGATCCGCCGGCACTCCGGGATCGTCTCGCGCCGCTTCGGCGACGCGGAGGAG
ACCGTGGTCGGCATGGCGGTCGCCGCGTCGCTCAAGGCGCTCGCCCAGGCCGGGGTGGCC
GCCGAGGAGGTGGACATGGTCCTGCTGGCGACCATGTCCCACCTGGAGCAGTCCCCCGCC
GCCGCGCCGCAGATCGCCCACCTGACGGGTGCCTCGTCGGCCGGCGCGATGGACGTGAGC
GCGGCCTGCGCCGGCTTCGTGCACGCGCTGGCGGTGGCCGACGCGCTGATCAGGACGGGG
GCCGCCCGGCGGGTGCTGGTGGTCGGCTCGGAGAAGATGACCGACATCATCGACCTGCGG
GACCGGGCGACCGCGTTCCTGTTCGGCGACGGCGCCGGAGCGGTCGTGGTCGGGCCCGCC
GACACCCCGGGGATCGGCCCGGTGGTCTGGGGGTCCGACGGCGGACACCGGGAGGCCATC
GCGCACTCCGGTTCGTGGTTGGAACTGCGGGACGGCCAGGCCGCCTGGCCGACCCTGCGG
ATGAACGGCCCCAGCGTCTACCGGTGGGCGATAGGGACCGTCCCGCAGGTCTGCCGCCGG
GCGCTCGCCGCGGCAGGGACCGACCCCGCGGAACTGGGCGCGTTCATCCCGCACCAGGCC
AACCTGCGCATCGTCGACGCCGCGGTGGCCGCCCTCGGACTGCCTCCCCATGTGGCGGTG
TCCCGGGACGTGACGGACACCGGCAACACCTCGGCCGCCTCCATCCCGCTGGCGATGGAA
CGCATGGTGGCCCAGGGCCGGGCCGGCAGCGGCGACCTCGCCCTGCTCGTCGGCTTCGGA
GCCGGGCTGACGCACGCCGCGATGGTGGTCGCCCTGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (Family)
 [14-330]  3.30000000000002e-99 TIGR00747
TIGR00747   FabH
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [242-331]  8.00000000000001e-29 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [117-194]  2.80000000000001e-29 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [14-170]  8.00000000000001e-54 G3DSA:3.40.47.10 [171-330]  1.40000000000001e-44 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [14-332]  2.39999798157265e-56 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit