close all open/close all

CDS information : Rever_00090


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction10,681 / 8,942 / - [in whole cluster]
10,681 / 8,942 / - [in contig]
Locationcomplement(8942..10681) [in whole cluster]
complement(8942..10681) [in contig]
TypeCDS
Length1,740 bp (579 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative carboxylic acid--ACP ligase
putative acyl-ACP synthetase
Product (GenBank)putative CoA ligase
Gene
Gene (GenBank)revS
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
Q6E7K9
PmId
[15217615] Structure and biosynthesis of the jamaicamides, new mixed polyketide-peptide neurotoxins from the marine cyanobacterium Lyngbya majuscula. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>putative carboxylic acid--ACP ligase [putative CoA ligase]
MELALPAELAPTLPEALRLRSEQQPDTVAYVFLRDGETPEETLTYGRLDRAARARAAALE
AAGLAGGTAVLLYPSGLEFVAALLGCMYAGTAGAPVQVPTRRRGMERARRIADDAGAKTI
LTTTAVKREVEEHFADLLTGLTVIDTESLPDVPDDAPAVRLPGPDDVALLQYTSGSTGDP
KGVEVTHANFRANVAETVELWPVRSDGTVVNWLPLFHDMGLMFGVVMPLFTGVPAYLMAP
QSFIRRPARWLEAISRFRGTHAAAPSFAYELCVRSVADTGLPAGLDLSSWRVAVNGAEPV
RWTAVADFTEAYAPAGFRPQAMCPGYGLAENTLKLSGSPEDRPPTLLRADAAALQDGRVV
PLTGPGTDGVRLVGSGVTVPSSRVAVVDPGTGTEQPAGRVGEIWINGPCVARGYHGRPAE
SAESFGARIAGQEARGTWLRTGDLGFLHDGEVFVAGRLKDVVIHQGRNFYPQDIELSAEV
SDRALHPNCAAAFALDDGRTERLVLLVEADGRALRNGGADALRARVHDAVWDRQRLRIDE
IVLLRRGALPKTSSGKVQRRLARSRYLDGEFGPAPAREA
selected fasta
>putative carboxylic acid--ACP ligase [putative CoA ligase]
ATGGAACTCGCCCTGCCGGCCGAGTTGGCCCCCACCCTGCCCGAGGCGTTGCGGCTGCGG
AGCGAGCAGCAGCCGGACACCGTCGCGTACGTCTTCCTGCGCGACGGCGAGACCCCCGAG
GAGACCCTGACCTACGGACGGCTCGACCGGGCGGCCCGGGCCCGGGCGGCCGCGCTGGAG
GCGGCGGGGCTGGCCGGCGGCACCGCCGTCCTGCTGTACCCGTCCGGCCTGGAGTTCGTC
GCCGCGCTGCTCGGGTGCATGTACGCCGGGACCGCGGGCGCGCCCGTGCAGGTGCCGACC
CGGCGCCGCGGCATGGAGCGCGCGCGCCGCATCGCCGACGACGCGGGCGCGAAGACGATC
CTCACCACGACCGCCGTCAAGCGGGAGGTGGAGGAGCACTTCGCCGACCTGCTGACCGGG
CTGACGGTGATCGACACCGAGTCGCTGCCGGACGTCCCGGACGACGCCCCGGCCGTGCGC
CTCCCCGGCCCGGACGACGTCGCGCTGCTCCAGTACACCTCGGGCTCCACCGGGGACCCC
AAGGGCGTCGAGGTCACGCACGCCAACTTCCGCGCCAACGTGGCGGAGACCGTGGAGCTG
TGGCCCGTGCGCTCCGACGGGACGGTGGTCAACTGGCTGCCGCTCTTCCACGACATGGGC
CTGATGTTCGGCGTGGTGATGCCGCTGTTCACCGGCGTCCCCGCCTACCTGATGGCCCCG
CAGTCGTTCATCCGGCGGCCGGCGCGCTGGCTGGAGGCGATCTCCCGGTTCCGCGGCACC
CACGCCGCCGCGCCCAGCTTCGCCTACGAGCTGTGCGTGCGCTCGGTCGCCGACACCGGC
CTGCCCGCCGGGCTGGACCTGTCCTCCTGGCGGGTGGCGGTCAACGGCGCCGAACCGGTG
CGCTGGACGGCCGTGGCGGACTTCACCGAGGCGTACGCCCCGGCCGGCTTCCGCCCGCAG
GCGATGTGCCCGGGGTACGGCCTGGCCGAGAACACCCTGAAGCTCAGCGGCAGCCCGGAG
GACCGCCCGCCCACCCTGCTGCGCGCCGACGCCGCCGCGCTCCAGGACGGCCGGGTGGTG
CCGCTGACCGGGCCGGGGACGGACGGTGTGCGGCTGGTGGGGTCCGGGGTGACCGTGCCC
TCCTCGCGGGTGGCCGTCGTGGACCCCGGCACCGGCACGGAGCAGCCGGCCGGCCGGGTC
GGCGAGATCTGGATCAACGGCCCCTGCGTGGCCCGCGGTTACCACGGGCGGCCGGCGGAG
AGCGCCGAGTCCTTCGGCGCCCGGATCGCCGGGCAGGAGGCGCGCGGCACCTGGCTGCGG
ACCGGCGACCTGGGCTTCCTGCACGACGGCGAGGTCTTCGTCGCCGGCCGCCTGAAGGAC
GTGGTCATCCACCAGGGCCGCAACTTCTACCCGCAGGACATAGAGCTGTCGGCGGAGGTG
TCGGACCGGGCGCTGCACCCCAACTGCGCCGCGGCCTTCGCCCTGGACGACGGGCGGACC
GAGCGGCTGGTGCTCCTGGTCGAGGCCGACGGCCGGGCGCTGCGCAACGGCGGCGCCGAC
GCGCTGCGGGCGCGGGTGCACGACGCGGTCTGGGACCGGCAGCGGCTGCGGATCGACGAG
ATAGTGCTGCTGCGCCGCGGGGCGCTGCCGAAGACCTCCAGCGGCAAGGTGCAGCGCCGG
CTGGCCCGCAGCCGCTACCTGGACGGCGAGTTCGGCCCGGCACCGGCGCGGGAGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [44-475]  1.39999999999997e-85 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [170-181]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [548-572]  8.20000000000001e-05 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit