close all open/close all

CDS information : Rever_00100


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction12,050 / 10,719 / - [in whole cluster]
12,050 / 10,719 / - [in contig]
Locationcomplement(10719..12050) [in whole cluster]
complement(10719..12050) [in contig]
TypeCDS
Length1,332 bp (443 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative crotonyl-CoA reductase
Product (GenBank)putative CoA reductase carboxylase
Gene
Gene (GenBank)revT
EC number1.3.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
Q53865
PmId
[8521864] Purification of crotonyl-CoA reductase from Streptomyces collinus and cloning, sequencing and expression of the corresponding gene in Escherichia coli. (Eur J Biochem. , 1995)
ACC
Q9RNU6
PmId
[10542184] Role of crotonyl coenzyme A reductase in determining the ratio of polyketides monensin A and monensin B produced by Streptomyces cinnamonensis. (J Bacteriol. , 1999)
ACC
B8XVS5
PmId
[17548827] Synthesis of C5-dicarboxylic acids from C2-units involving crotonyl-CoA carboxylase/reductase: the ethylmalonyl-CoA pathway. (Proc Natl Acad Sci U S A. , 2007)
[19458256] Carboxylation mechanism and stereochemistry of crotonyl-CoA carboxylase/reductase, a carboxylating enoyl-thioester reductase. (Proc Natl Acad Sci U S A. , 2009)

close this sectionSequence

selected fasta
>putative crotonyl-CoA reductase [putative CoA reductase carboxylase]
MEPMTEAVLRGADPDELSRIPVPEDFVAAHLRAEDADAFIGMDSASKDVRKSVRVGRVPM
PELAPDEVLVAVMASSINYNTVWSAMFEPISTFDALKRLGRGGGWDARHDQPYHVLGSDA
SGVIVRTGSGVRRWKVGDRVSVSPVVADTEDPRTHNDSLLSDMWAWGYETNFGGLAHYSV
VRSAQLMPKPAHLSWEEAACIPLCGGTSYRMLIGEHGARMKQGDIVLIWGATGGLGSFAV
QMVKNGGGVPIGVVSSERKAEIARKLGCDVVINRQEIGIGTQPEPGPATVKLAKRLGRAI
RQEVGEDPHIVFDYIGKATFGMSVIVVRRGGAVVTCGSSSGFEHNYDNRYLWMNLKRIIG
SHGMNLSEATETMRLSKLGKLSPVLSAVYPLAEAGEATRLVQTNAHTGKVGVLCMAPEEG
LGVTDPQLRARLGEQKLNPLRSV
selected fasta
>putative crotonyl-CoA reductase [putative CoA reductase carboxylase]
ATGGAACCCATGACCGAGGCAGTGCTCCGGGGCGCCGACCCGGACGAGTTGAGCCGAATT
CCGGTCCCCGAGGACTTCGTCGCCGCGCATCTGCGGGCCGAGGACGCCGACGCGTTCATC
GGCATGGACAGCGCCAGCAAGGACGTGCGCAAGTCGGTGCGGGTGGGCCGGGTGCCGATG
CCGGAACTGGCGCCCGACGAGGTGCTGGTGGCCGTGATGGCCAGCTCCATCAACTACAAC
ACCGTGTGGTCGGCGATGTTCGAGCCCATCTCGACCTTCGACGCGCTGAAGCGGCTGGGC
CGCGGCGGCGGTTGGGACGCGCGGCACGACCAGCCGTACCACGTGCTCGGCTCGGACGCG
TCCGGCGTCATCGTGCGGACCGGCTCCGGGGTGCGCCGCTGGAAGGTGGGCGACCGGGTC
TCCGTCTCCCCCGTGGTGGCGGACACCGAGGACCCCCGCACCCACAACGACAGCCTGCTC
TCCGACATGTGGGCGTGGGGCTACGAGACCAACTTCGGCGGCCTGGCGCACTACTCGGTG
GTCCGCTCCGCCCAGCTCATGCCCAAGCCCGCCCACCTGAGCTGGGAGGAGGCCGCCTGC
ATCCCGCTGTGCGGCGGCACCTCCTACCGGATGCTGATCGGCGAGCACGGCGCCCGGATG
AAGCAGGGCGACATCGTGCTGATCTGGGGCGCGACCGGCGGGCTCGGCTCGTTCGCCGTC
CAGATGGTCAAGAACGGCGGCGGCGTTCCGATCGGCGTGGTCAGCTCGGAGCGCAAGGCG
GAGATCGCCCGCAAGCTCGGCTGCGACGTCGTGATCAACCGCCAGGAGATCGGCATCGGC
ACGCAGCCGGAGCCCGGGCCGGCGACGGTGAAACTCGCCAAGCGGCTGGGCCGCGCGATC
CGCCAGGAGGTGGGCGAGGACCCGCACATCGTCTTCGACTACATCGGCAAGGCCACCTTC
GGCATGTCGGTCATCGTGGTCCGCCGCGGCGGCGCCGTCGTCACCTGCGGGTCGAGCTCC
GGCTTCGAGCACAACTACGACAACCGCTACCTGTGGATGAACCTCAAGCGCATCATCGGC
AGCCACGGGATGAACCTCAGCGAGGCGACCGAGACGATGCGGCTGAGCAAGCTCGGCAAG
CTCTCCCCGGTCCTGTCCGCGGTGTACCCGCTCGCCGAGGCCGGCGAGGCGACCCGGCTG
GTGCAGACGAACGCGCACACCGGCAAGGTCGGCGTGCTGTGCATGGCACCCGAGGAGGGA
CTCGGCGTCACCGACCCCCAGCTACGCGCCCGGCTGGGTGAGCAGAAGCTCAACCCGCTC
CGGTCCGTGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010085 Crotonyl-CoA reductase (Family)
 [32-425]  TIGR01751
TIGR01751   Crot-CoA-red
IPR011032 GroES-like (Domain)
 [42-237]  6.69999687625999e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [234-375]  8.00000000000001e-30 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [66-188]  2.6e-09 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [231-382]  8.70000000000003e-20 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-28]  0.083 Signal
Bacteria, Gram-positive   
TMHMM No significant hit