close all open/close all

CDS information : Rever_00120


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction28,332 / 39,506 / + [in whole cluster]
28,332 / 39,506 / + [in contig]
Location28332..39506 [in whole cluster]
28332..39506 [in contig]
TypeCDS
Length11,175 bp (3,724 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GenerevB
Gene (GenBank)revC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
8 malonyl-CoA
KS34..408
AT601..914
DH962..1127
ER1456..1762
KR1772..1952
ACP2049..2123
KS2147..2519
AT2705..3010
KR3297..3477
ACP3573..3647

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MATEEQLRSYLKTAVANSREAQRQLNEIKGRRDEPLAIVGMACRYPGGVTGPDGLWDLVA
SGTDAVSVFPADRGWDADALYDPEGAPGTTSTREGGFVDAVADFDAGFFGISPREALAMD
PQQRLLLEVAWESLEHAGIDPAGLAGTATGVFVGASSSGYMEAIGGMPETESHRMTSGLL
SVISGRLSYVLGLEGPAVTVDTACSSSLVAMHWAGQALRSDECSLAIAGGVNVAVSPAGF
VEFTRQGGLAPDGRCKAFAEAADGTGWSEGAGVVVLERLSDARRNGHRVLAVVRSSAVNQ
DGASNGLTAPNGPSQRRVIRQALASVGLAPTEVDAVEAHGTGTVLGDPIEAQALLATYGQ
GRPEDRPLWLGTIKSNIGHSQAAAGVASVIKMVQAIRHGVLPRTLHVDEPSKRVDWSRGR
VRLLTEEQPWPETGRPRRAGVSSFGVSGTNAHLILEAAPALAPALEPAPAPAPGSAETAA
SASGNTAAAAAPGAAARTADDTPESGAAVSGALPWVLSARSPQALAAQAGRLLEHVEQDP
RPDPADVAYSLLRSRSLFDHRAVVVGADREELTAGLRALAAGEPAAAVAEGVAEAGRHKP
VFVFPGQGSQWVGMAGELRAASPVFAQALDACADALAEFVDWSLLDALDDEDLLARVDVV
QPALWAVMVSLARVWESLGVRPAAVVGHSQGEIAAACVAGALSLSDGARVVALRSRAIAE
ELAGDGGMVAVPLPVAQAEELLARWGDRVSVAAINGPGSVVVSGVPDALDELLAHCEDTG
VRAKRVPVDYASHSAAVERIERRLAADLAAVAPRSGAVPMYSTVTAEPIDTAGLDAAYWY
RNLRRTVRFEDANRALAEAGYTVFVEISPHPVLTMPVQDTLGDEAVVTGTLRRHEGGPAR
LLLSAAHLYAHGVPVAWDGLFAGAAPAVVDLPTYAFQRRRYWPEGGTAAADVTAAGLEEV
RHPLLGAVLSSPEGGGAVFTSRLSVASQPWLADHAVRGVVLFPGTGFVELVVHAADVVGC
GRVRELIVEAPLVLPESGGMQVQVVMGAPEDGRRTFTVYARPDGGGDRSWVRHAAGVVEG
AEAPEAAGFEPLAGAWPPPGAEALETGDVYERTAGGGFAYGPTFQGLTRAWRQDGRVFAE
VALPEQQWGRAGAFGLHPALLDSVLHASLFAGLAPAEFGRLPFSFEDVVLHASGATEVRA
CLTPTGPDSLSVLVTDPAGGPVLSVGSLVMRPLTPQTLTAAGRRDEAVLSVEWTELPAGA
EESAGPGAGSGAGLDAVLGPVAAGPDAEVPWLPGVPVHRDLADVRPEAGRPVVLAVAAQD
GPVVAAAHAAARWVLEQVQTWLRDAAFAGSSLLVLTRGAVAAGATGAGGEVADLAAATAW
GLVRSAQAENPGRITLVDTDPSAAVAAGPLAAALAGGEPQLALRAGRLRAPRLARADVGL
VAPESGAWHLDSMAKGTLENLRLVPFPEAERALSDGEVRIEVRAAGLNFRDVLNALGMYP
DPDEPMGSDVAGVVTEVGAGVTDLRAGDRVMGITNGGLGSAVVVDRRLVAPVPAGWSFAT
AASVPTAFLTAYYALVDLAELRSGERVLVHAGAGGVGMAALQIAGHLGAEVYSTASDGKR
DLLRERGVEAARLASSRTLDFEEAFLRETGGCGVDVVLNSLTGEFIDASLRLMPGGGRFV
EMGKADLRRSEEVAALHEGVRYRSFDLVEAHPDRLQRMLLELVGLFESGVLVPLPVVEWD
VRRAPEAFRFMSQARHVGKIVLTVGRRVVGEGAVLVTGGTGGLGGVVARHLVVEHGVRDL
VLVSRRGLGAPGAEELVAELSGRGARVEVVACDVSDREALAGVVAGMCASGVLAGVVHTA
GVVDDGLVSSLSGERLGPVLAPKVDAGWWLHELTRGLDLSLFAVFSSMSGLVGAPGQGNY
AAANVFLDALVERRRSEGLPGVSMAWGPWTPEVGLTGALSEADMRRLERSGMPPLSVEQG
MRLFDQAATAGIALVGLGRVDAAVLRGRADLPLMLRALVGGRAPRAVAGRQQQSGGLAGQ
LAGLSAQQRDQHLLALVRDNVAVVLGHGGGQDVDPGQAFRDSGFDSLTAVELRNRLQSAT
GLTLPATLVFDYPNATRLAAFLGERFGDTGASAAGPELPALVSVTDDPIAVVGMACRYPG
GVESPEDLWNLVVAGGDAMTPFPLDRGWDVEGIYDPTGTRPNTAVANEGGFLASAADFDA
GFFGISPREALAMDPQQRLLLEVVWEALERAEIDPADLAGTPAGVFVGSYHSSYGDLVAR
AGDAQAQMMTGGAQSVLSGRVSYVLGLEGPAVTVDTACSSSLVAMHLASQSLRSGESSLA
LAGGVTILATPGTFVEFSRQGGLAADGRCKAFAESADGTGFGEGVGIMVLERLSDARRNG
HPVLAVLRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAGGLAPTDVDAVEAHGTGTTLG
DPIEAQALLVAYGQDRPEDRPLWLGTVKSNIGHTQAAAGVAGAIKMVQAIRHGVLPSTRY
ADEPTSHVDWDQGRVRLLTEDQPWPETGHPRRAGVSSFGISGTNAHVILEAAPDTDADAA
AEPGTGAASDADADTAAEPGTAPAADSTDGTDGGGDAETVWVVSGRSEQALAAQAGRLLP
AVAAHHPADVGAALLGTRSLFEHRAVVVGRDREELTAGLRALATGAPAAHVVEGVARTRR
GLAVLFTGQGAQRLGMGRLLHAQSPVFAAAFDEVADELDRHLESPLRDVVWGGDQELLDR
TGWTQPALFAVEVALYRVLLSWGIRPDYLLGHSIGEVAAAHVAGVFSLPDACRLVAARSR
LMQALPAGGAMAAVEATEEEVTDRLTGGVSVAAVNAAESIVVAGPEDEVAAVQGHFTALG
RRTRRLRVSHAFHSALMEPMLDAFAAELEQLAYAEPALPVVSNVTGAPADLANPAYWVEQ
VRSAVRFADGLSWLVDHGVDTFVEAGPDAVLSGLAGALPGAASVALQRGDRAGRPVLLHA
LARLHVRGVAVDWTPLFAGRGRRRVELPTYAFQRRRYWPQAVPEQAAGRDPVDALFWESV
ESGTGELARSLGVADDALSHVVPALLRWRERRLRDAAADDWCYRQSWVPVDGPRADPAAP
ARWLAVVPEGDDPWTGAVLKALGPDVTVLSPEAADAEALARAGADRTGVVALAADGTSGL
TAVLRLVQEVRRAELAVPLWVATRAAVAARPGERVETVWQGGIWGLGRVAALELPDLWGG
LIDLPGEPDPVALDRLAGVLSGGHGEDQLAVRASGVLARRLVRAPGRGTGEAWTTGGTAL
VTGGTGGLGGYVARWLVERGAQHLVLMSRRGPDAPGADGLRAELEAAGAKVSVVAGDVTD
RATMAELLAGLPADLPLRSVFHTAGVLHEPTPVEALSLETLHDSLGAKVEGALLLDELTG
ETDLDAFVLFSSGAASWGGSGQGGYAAGNACLDSLAEYRRARGRTATSIAWGTWAEAGMA
AANTDEHDYLVRLGVLPMQPEPAVAAMQRVLEEDATTVTVSDMDWSRFAPAFSLARPSRL
LALLQDTGPAAAEPEADATAFAGQLAAVPAAERREYLVTLVCDHAAAVLGHGSGDELDPE
TAFRDAGFDSLTAVELRDRLQAMTGLTLPATLVFDYPNPLKLAALLDETAGGTAGEGDEE
ELRRVLASVPPAKLRAAGLLDAVLALAEEAGQDTGEADGADEPDETDLMTADADDLVRIA
LGSA
selected fasta
>polyketide synthase [polyketide synthase]
ATGGCCACTGAAGAACAGCTGCGTTCCTATCTGAAGACGGCCGTGGCGAACTCGCGCGAG
GCGCAGCGGCAGCTGAACGAGATCAAGGGCAGGCGGGACGAGCCGCTCGCCATCGTGGGC
ATGGCCTGCCGCTACCCCGGCGGCGTGACCGGCCCCGACGGCCTCTGGGACCTGGTCGCC
TCGGGCACCGACGCGGTGTCGGTGTTCCCCGCCGACCGCGGCTGGGACGCCGACGCGCTC
TACGACCCGGAGGGCGCCCCCGGCACGACGTCCACCCGCGAGGGCGGCTTCGTGGACGCG
GTGGCGGACTTCGACGCGGGGTTCTTCGGGATCTCCCCGCGTGAGGCGTTGGCGATGGAC
CCGCAGCAGCGGCTGCTGCTGGAGGTGGCCTGGGAGTCGCTGGAGCACGCCGGCATCGAT
CCGGCGGGGCTCGCCGGGACGGCCACCGGCGTCTTCGTCGGGGCGTCCTCCTCGGGGTAC
ATGGAGGCGATCGGGGGCATGCCCGAGACCGAGAGCCACCGGATGACCAGCGGGCTGCTG
TCCGTCATCTCCGGCCGGCTGTCCTACGTCCTCGGGCTGGAGGGCCCGGCGGTGACCGTG
GACACCGCGTGCTCGTCGTCGCTGGTGGCCATGCACTGGGCCGGCCAGGCGCTGCGCTCG
GACGAGTGCTCGCTCGCCATCGCCGGCGGCGTGAACGTGGCGGTGAGCCCGGCGGGGTTC
GTGGAGTTCACCCGGCAGGGCGGCCTCGCGCCCGACGGCCGCTGCAAGGCGTTCGCCGAG
GCGGCCGACGGCACGGGCTGGTCCGAGGGCGCCGGCGTCGTGGTGCTGGAGCGGTTGTCG
GACGCGCGGCGCAACGGGCACCGGGTGCTGGCCGTGGTGCGGTCCAGCGCGGTGAACCAG
GACGGCGCGTCGAACGGGCTGACGGCGCCGAACGGTCCGTCGCAGCGCCGGGTGATCCGC
CAGGCCCTGGCGTCCGTCGGGCTCGCGCCCACCGAGGTCGACGCGGTCGAGGCGCACGGC
ACCGGCACCGTGCTGGGCGACCCGATCGAGGCGCAGGCGCTGCTGGCGACCTACGGCCAG
GGCCGCCCCGAGGACCGGCCGTTGTGGCTGGGCACGATCAAGTCCAACATCGGCCACTCG
CAGGCCGCCGCCGGTGTCGCGAGTGTGATCAAGATGGTGCAGGCGATACGCCACGGCGTG
CTCCCGCGCACCCTGCACGTGGACGAGCCGAGCAAGCGGGTGGACTGGAGCCGCGGCCGG
GTGCGGCTGCTGACCGAGGAGCAGCCGTGGCCGGAGACCGGCCGCCCGCGCCGCGCGGGC
GTGTCCTCCTTCGGCGTGTCCGGCACCAACGCGCACCTCATCCTCGAAGCCGCGCCCGCG
CTTGCACCCGCGCTCGAACCCGCGCCTGCTCCCGCTCCCGGGTCCGCGGAGACCGCCGCT
TCCGCGTCCGGGAACACGGCCGCCGCGGCCGCCCCCGGCGCGGCCGCCCGGACCGCCGAC
GACACCCCGGAGAGCGGGGCCGCCGTCTCCGGAGCCCTGCCGTGGGTGCTCTCCGCCCGG
TCCCCGCAGGCGCTCGCCGCGCAGGCCGGACGGCTGCTGGAGCACGTCGAGCAGGACCCG
CGGCCGGACCCCGCCGACGTGGCGTACTCGCTGCTGCGCTCCCGTTCCCTGTTCGACCAC
CGCGCCGTGGTCGTCGGCGCCGACCGGGAGGAACTGACCGCCGGGCTGCGCGCGCTGGCC
GCCGGGGAGCCGGCCGCCGCCGTCGCCGAGGGCGTCGCCGAGGCCGGCCGGCACAAACCG
GTGTTCGTCTTCCCCGGTCAGGGCTCCCAGTGGGTCGGCATGGCCGGCGAACTGCGTGCG
GCCTCACCGGTGTTCGCCCAGGCACTCGACGCGTGCGCGGACGCGCTCGCCGAGTTCGTG
GACTGGTCGCTGCTGGACGCCCTGGACGACGAGGACCTGCTCGCCCGCGTCGACGTCGTG
CAACCCGCCCTGTGGGCGGTCATGGTGTCGCTGGCCCGGGTGTGGGAGTCGCTCGGCGTG
CGCCCCGCCGCAGTGGTGGGCCACTCCCAGGGCGAGATCGCCGCGGCCTGCGTGGCCGGC
GCGCTGTCGCTGTCCGACGGCGCCCGGGTCGTCGCCCTGCGCAGCCGCGCCATCGCCGAG
GAACTGGCCGGCGACGGCGGCATGGTCGCCGTCCCGCTGCCGGTGGCACAGGCGGAGGAA
CTCCTCGCCCGCTGGGGCGACCGCGTCTCCGTCGCCGCGATCAACGGCCCCGGGTCCGTG
GTCGTCTCCGGCGTCCCGGACGCCCTCGACGAACTCCTCGCCCACTGCGAGGACACCGGG
GTGCGGGCGAAGCGGGTCCCGGTGGACTACGCCTCGCACTCCGCCGCGGTCGAGCGGATC
GAACGGCGGCTCGCGGCGGACCTCGCCGCCGTCGCCCCCCGGTCCGGCGCGGTGCCGATG
TACTCGACCGTCACCGCGGAGCCGATCGACACCGCCGGGCTCGACGCCGCCTACTGGTAC
CGCAACCTGCGCCGGACCGTCCGCTTCGAGGACGCCAACCGCGCGCTGGCCGAGGCCGGC
TACACGGTGTTCGTCGAGATCAGCCCGCACCCGGTGCTCACGATGCCGGTGCAGGACACG
CTCGGCGACGAGGCCGTGGTCACCGGCACGCTGCGCCGCCACGAGGGCGGTCCGGCCCGC
TTGCTGCTGTCCGCGGCCCACCTGTACGCCCACGGCGTGCCGGTCGCGTGGGACGGACTG
TTCGCCGGTGCCGCGCCGGCCGTGGTGGACCTGCCGACGTACGCCTTCCAGCGGCGCCGC
TACTGGCCCGAGGGCGGCACCGCCGCGGCCGACGTGACGGCCGCCGGCCTGGAGGAGGTG
CGGCACCCGTTGCTCGGCGCGGTGCTCTCCTCGCCCGAGGGCGGCGGGGCGGTGTTCACC
TCGCGGCTGTCGGTCGCGTCGCAGCCCTGGCTGGCCGACCACGCCGTGCGGGGTGTGGTG
CTCTTCCCTGGCACCGGCTTCGTCGAACTGGTCGTCCACGCCGCGGACGTGGTCGGCTGC
GGCCGGGTCCGCGAGCTGATCGTGGAGGCGCCCCTGGTGCTGCCCGAGAGCGGCGGGATG
CAGGTCCAGGTCGTCATGGGCGCGCCCGAGGACGGCCGGCGCACGTTCACGGTGTACGCG
CGCCCCGACGGCGGCGGGGACCGGTCCTGGGTCCGGCACGCCGCCGGCGTGGTGGAGGGC
GCGGAGGCACCGGAGGCCGCCGGGTTCGAGCCGCTGGCCGGCGCGTGGCCGCCCCCGGGC
GCCGAGGCGCTGGAGACCGGCGACGTGTACGAGCGGACCGCCGGCGGCGGCTTCGCCTAC
GGCCCCACCTTCCAGGGCCTGACCCGCGCATGGCGCCAGGACGGCCGGGTCTTCGCCGAA
GTGGCGCTGCCCGAGCAGCAGTGGGGCCGGGCCGGGGCGTTCGGCCTGCACCCGGCGCTG
CTGGACTCGGTGCTGCACGCCTCGCTGTTCGCGGGGCTGGCACCCGCCGAGTTCGGCCGG
CTGCCGTTCAGCTTCGAGGACGTGGTGCTGCACGCCTCCGGCGCCACCGAGGTGCGCGCC
TGCCTGACGCCGACCGGGCCCGACTCGCTGTCGGTCCTGGTGACCGACCCGGCGGGCGGC
CCGGTGCTGTCGGTGGGCTCGCTGGTGATGCGCCCGCTGACCCCGCAGACGCTGACGGCC
GCCGGGCGCCGCGACGAGGCCGTCCTGTCCGTGGAGTGGACCGAACTGCCCGCCGGGGCC
GAGGAGTCCGCGGGCCCGGGCGCGGGCTCCGGCGCGGGCCTCGACGCGGTGCTCGGCCCG
GTGGCGGCGGGCCCGGACGCGGAGGTGCCGTGGCTGCCGGGGGTGCCGGTCCACCGGGAC
CTGGCGGACGTGCGGCCGGAGGCGGGCCGCCCCGTGGTGCTGGCCGTGGCGGCGCAGGAC
GGTCCGGTCGTGGCGGCCGCCCACGCGGCTGCCCGCTGGGTCCTGGAGCAGGTGCAGACC
TGGCTGCGGGACGCGGCGTTCGCCGGTTCCTCGCTGCTGGTGCTGACCCGCGGCGCGGTC
GCCGCCGGGGCCACCGGGGCCGGCGGGGAGGTGGCCGACCTGGCCGCCGCCACGGCCTGG
GGCCTGGTGCGTTCGGCGCAGGCGGAGAACCCCGGCCGGATCACCCTGGTCGACACCGAC
CCGTCCGCCGCCGTGGCTGCGGGCCCCCTCGCCGCGGCACTGGCCGGCGGCGAGCCGCAA
CTCGCGCTGCGGGCGGGCCGGTTGCGCGCACCGCGGTTGGCGCGTGCGGATGTCGGGCTG
GTGGCGCCGGAGTCGGGTGCCTGGCACCTGGACTCCATGGCGAAGGGGACGTTGGAGAAC
CTGCGGTTGGTGCCGTTCCCGGAGGCGGAGCGGGCGTTGTCCGACGGTGAGGTGCGGATC
GAGGTGCGGGCGGCGGGGTTGAACTTCCGCGACGTCCTCAACGCCCTGGGCATGTACCCC
GACCCGGACGAGCCGATGGGCAGCGACGTGGCCGGCGTGGTCACCGAGGTCGGCGCGGGC
GTGACCGACCTGCGGGCCGGCGACCGCGTCATGGGCATCACCAACGGCGGCCTCGGCTCG
GCCGTGGTGGTCGACCGGCGGCTGGTCGCGCCGGTCCCCGCGGGCTGGTCCTTCGCCACC
GCCGCCTCCGTGCCGACGGCGTTCCTGACCGCGTACTACGCGCTGGTGGACCTGGCCGAA
CTGCGGTCGGGCGAGCGGGTGCTGGTGCACGCGGGCGCCGGCGGCGTCGGCATGGCCGCG
CTCCAGATCGCCGGACACCTCGGCGCCGAGGTCTACAGCACCGCCAGCGACGGCAAGCGC
GACCTGCTGCGGGAGCGGGGGGTGGAGGCGGCGCGTCTGGCGTCGTCGCGGACGCTGGAC
TTCGAGGAGGCGTTCCTGCGGGAGACCGGGGGGTGCGGGGTGGACGTGGTGTTGAACTCC
CTGACGGGGGAGTTCATCGACGCGTCGCTGCGGTTGATGCCGGGCGGGGGTCGCTTCGTC
GAGATGGGCAAGGCCGACCTGAGGCGGAGCGAGGAGGTCGCGGCACTCCACGAGGGGGTC
CGCTACCGCTCCTTCGACCTCGTCGAGGCGCACCCTGACCGCCTCCAGCGGATGTTGCTG
GAGTTGGTGGGGTTGTTCGAGTCGGGTGTGTTGGTGCCGTTGCCGGTGGTGGAGTGGGAT
GTGCGGCGGGCGCCGGAGGCGTTCCGGTTCATGAGTCAGGCGCGGCATGTGGGCAAGATC
GTGTTGACGGTGGGTCGGCGGGTGGTGGGTGAGGGGGCGGTTCTGGTCACTGGGGGGACT
GGTGGTCTGGGGGGTGTGGTGGCGAGGCATCTGGTGGTGGAGCACGGGGTGCGGGATCTG
GTGTTGGTGTCGCGTCGGGGGTTGGGGGCGCCGGGTGCGGAGGAGTTGGTGGCGGAGCTT
TCGGGTCGGGGTGCTCGGGTGGAGGTGGTGGCGTGTGATGTGAGTGATCGTGAGGCGTTG
GCGGGGGTGGTGGCGGGGATGTGTGCGTCGGGTGTGTTGGCGGGTGTGGTGCATACGGCG
GGTGTGGTGGATGACGGGTTGGTGTCGTCGTTGTCGGGGGAGCGGTTGGGTCCGGTGTTG
GCGCCGAAGGTGGATGCGGGGTGGTGGCTGCATGAGTTGACGCGGGGGTTGGATCTGTCG
TTGTTCGCGGTGTTCTCGTCGATGTCGGGTCTGGTGGGGGCTCCGGGGCAGGGCAACTAC
GCGGCGGCGAACGTGTTCCTGGACGCGTTGGTGGAGCGGCGTCGGAGTGAGGGGCTGCCG
GGCGTGTCGATGGCGTGGGGTCCGTGGACCCCCGAGGTCGGCCTCACCGGCGCCCTGTCC
GAGGCCGACATGCGTCGCCTGGAGCGGTCCGGCATGCCGCCGTTGTCGGTGGAGCAGGGC
ATGCGGCTGTTCGACCAGGCCGCAACAGCGGGCATCGCGCTGGTGGGACTCGGCCGGGTG
GACGCCGCCGTGCTGCGCGGCCGCGCCGACCTGCCCCTGATGCTCCGCGCGCTGGTCGGC
GGCCGGGCCCCCCGCGCCGTGGCCGGCCGCCAGCAGCAGTCCGGGGGCCTCGCGGGGCAG
TTGGCCGGGCTCAGTGCCCAGCAGCGCGACCAGCACCTGCTGGCCCTGGTCCGCGACAAC
GTCGCGGTCGTCCTCGGCCACGGCGGCGGTCAGGACGTCGATCCCGGCCAGGCGTTCCGC
GACTCCGGCTTCGACTCGCTCACCGCGGTCGAACTGCGCAACCGCCTCCAGAGCGCGACC
GGCCTCACACTGCCGGCCACGCTCGTCTTCGACTACCCCAACGCGACCCGGCTCGCCGCC
TTCCTGGGCGAGCGGTTCGGCGACACCGGCGCCTCCGCCGCCGGGCCGGAGCTGCCCGCG
CTCGTCTCGGTGACCGACGACCCGATCGCGGTCGTGGGCATGGCCTGCCGCTACCCGGGC
GGCGTGGAGAGCCCGGAGGACCTGTGGAACCTGGTGGTCGCCGGCGGCGACGCCATGACG
CCGTTCCCGCTGGACCGCGGCTGGGACGTGGAGGGCATCTACGACCCGACGGGCACCCGC
CCGAACACCGCGGTGGCCAACGAGGGCGGGTTCCTGGCCTCCGCCGCCGACTTCGACGCC
GGGTTCTTCGGGATCTCCCCGCGCGAGGCGCTGGCCATGGATCCGCAGCAGCGGCTCCTG
CTGGAGGTCGTCTGGGAGGCCCTGGAACGCGCCGAGATCGACCCGGCCGACCTCGCCGGC
ACCCCGGCCGGCGTCTTCGTCGGCAGCTACCACTCCAGCTACGGGGACCTGGTCGCCCGC
GCGGGTGACGCGCAGGCCCAGATGATGACCGGGGGCGCGCAGAGCGTGCTGTCCGGGCGG
GTCTCCTACGTCCTCGGGCTGGAGGGCCCGGCGGTGACGGTGGACACCGCGTGCTCGTCG
TCGCTCGTCGCGATGCACCTGGCGAGCCAGTCGCTGCGCTCGGGCGAGAGCTCGCTCGCG
CTCGCGGGCGGCGTCACCATCCTCGCCACCCCCGGCACGTTCGTGGAGTTCAGCCGGCAG
GGCGGGCTCGCGGCCGACGGGCGCTGCAAGGCGTTCGCCGAGTCCGCCGACGGCACCGGC
TTCGGCGAGGGCGTCGGGATCATGGTGCTGGAGCGGCTCTCGGACGCCCGCCGCAACGGG
CACCCCGTCCTCGCCGTCCTGCGCTCCAGCGCCGTCAACCAGGACGGCGCGTCCAACGGC
CTGACCGCCCCCAACGGCCCGTCCCAGCAGCGGGTCATCCGCCAGGCCCTGGCCGCCGGC
GGGCTCGCCCCGACCGACGTCGACGCGGTGGAGGCGCACGGCACCGGCACGACGCTGGGC
GACCCGATCGAGGCGCAGGCGCTGCTGGTCGCGTACGGCCAGGACCGCCCCGAGGACCGG
CCGCTGTGGCTGGGCACCGTGAAGTCCAACATCGGGCACACCCAGGCCGCCGCCGGTGTC
GCCGGGGCGATCAAGATGGTGCAGGCCATCCGGCACGGCGTGCTGCCGAGCACCCGGTAC
GCCGACGAGCCCACCTCGCACGTCGACTGGGACCAGGGCCGGGTGCGGCTGCTGACCGAG
GACCAGCCCTGGCCCGAGACCGGACACCCGCGCCGGGCCGGCGTCTCCTCGTTCGGCATC
TCCGGCACCAACGCGCACGTCATCCTGGAGGCCGCCCCCGACACCGACGCCGACGCCGCG
GCCGAGCCCGGCACCGGCGCTGCGTCCGACGCCGACGCCGACACTGCGGCCGAGCCCGGC
ACCGCGCCCGCCGCGGACAGCACGGACGGCACGGACGGCGGCGGCGACGCCGAGACGGTC
TGGGTGGTCTCCGGCCGCTCGGAACAGGCGCTGGCCGCGCAGGCCGGACGGCTGCTGCCG
GCCGTGGCGGCGCACCACCCGGCGGACGTGGGCGCCGCGCTGCTGGGCACCCGCTCGCTG
TTCGAGCACCGGGCGGTCGTCGTGGGCAGGGACCGCGAGGAACTGACCGCCGGACTGCGC
GCGCTGGCCACCGGCGCGCCGGCCGCCCACGTGGTCGAGGGCGTGGCCCGCACCCGCCGC
GGGCTCGCGGTGCTCTTCACCGGCCAGGGCGCGCAGCGCCTCGGCATGGGCCGCCTGCTC
CACGCCCAGTCTCCGGTGTTCGCCGCCGCCTTCGACGAGGTGGCCGACGAGTTGGACCGG
CACCTGGAGTCCCCGCTGCGGGACGTGGTCTGGGGCGGGGACCAGGAGCTGCTGGACCGC
ACCGGCTGGACGCAGCCCGCCCTGTTCGCGGTCGAGGTCGCGCTGTACCGGGTGCTGCTG
TCCTGGGGCATCCGCCCGGACTACCTGCTCGGCCACTCCATCGGCGAGGTGGCCGCCGCC
CACGTGGCCGGGGTCTTCTCGCTGCCGGACGCGTGCCGGCTGGTGGCCGCGCGCTCCCGC
CTGATGCAGGCGCTGCCGGCCGGCGGGGCGATGGCCGCCGTCGAGGCGACCGAGGAGGAG
GTGACCGACCGGCTCACCGGCGGGGTGTCCGTCGCGGCGGTCAACGCCGCCGAGTCGATC
GTCGTCGCCGGACCCGAGGACGAAGTGGCCGCGGTGCAGGGGCACTTCACCGCGCTCGGT
CGGCGGACCCGCCGGCTGCGGGTCTCGCACGCCTTCCACTCCGCGCTCATGGAGCCGATG
CTCGACGCCTTCGCGGCGGAACTGGAGCAACTGGCCTACGCCGAGCCCGCCCTGCCCGTC
GTGTCGAACGTGACCGGCGCGCCGGCGGACCTGGCCAACCCGGCCTACTGGGTCGAGCAG
GTCCGCTCCGCGGTCCGGTTCGCCGACGGGCTGAGCTGGCTGGTCGACCACGGCGTGGAC
ACCTTCGTGGAAGCGGGCCCGGACGCGGTGCTGTCCGGTCTGGCCGGCGCGCTGCCCGGG
GCGGCCTCGGTGGCGCTCCAGCGCGGCGACCGCGCCGGCCGCCCGGTCCTGCTGCACGCC
CTGGCCCGGCTCCACGTGCGGGGCGTGGCCGTCGACTGGACCCCGCTGTTCGCCGGGCGC
GGCCGGCGCCGGGTGGAGCTGCCGACGTACGCCTTCCAACGCCGCCGCTACTGGCCGCAG
GCCGTACCGGAGCAGGCGGCCGGCCGCGACCCGGTGGACGCCCTGTTCTGGGAGTCCGTG
GAGAGCGGCACGGGCGAGCTGGCCCGCTCGCTCGGCGTCGCGGACGACGCCCTGTCGCAC
GTGGTGCCGGCCCTGCTGCGCTGGCGTGAGCGCAGGCTGCGGGACGCGGCGGCCGACGAC
TGGTGCTACCGCCAGTCCTGGGTGCCCGTCGACGGCCCGCGCGCCGACCCGGCGGCGCCG
GCGCGCTGGCTGGCGGTCGTCCCCGAGGGCGACGACCCCTGGACCGGCGCCGTCCTGAAG
GCACTCGGCCCCGACGTCACCGTGCTCAGCCCCGAGGCCGCCGACGCCGAGGCGCTGGCG
CGGGCCGGCGCCGACCGCACCGGCGTGGTGGCGCTGGCCGCCGACGGCACGTCCGGACTC
ACCGCGGTCCTGCGGCTGGTCCAGGAGGTGCGGCGCGCGGAGCTGGCCGTCCCGCTGTGG
GTGGCCACCCGCGCCGCGGTCGCGGCCCGTCCCGGTGAGCGGGTCGAGACCGTGTGGCAG
GGCGGAATCTGGGGGCTCGGACGCGTCGCGGCCCTGGAACTTCCCGACCTGTGGGGCGGG
TTGATCGACCTGCCCGGCGAGCCCGACCCGGTGGCCCTGGACCGGCTGGCGGGCGTGCTG
TCCGGCGGCCACGGCGAGGACCAGCTCGCGGTGCGCGCCTCCGGCGTGCTGGCCCGCCGG
CTGGTGCGCGCGCCGGGCCGCGGCACCGGAGAGGCGTGGACGACCGGCGGCACGGCCCTG
GTCACCGGCGGCACCGGCGGCCTGGGCGGATACGTGGCCCGGTGGCTGGTCGAGCGGGGC
GCGCAGCACCTGGTGCTGATGTCCCGGCGCGGCCCGGACGCCCCCGGCGCCGACGGGCTG
CGGGCCGAACTGGAGGCCGCCGGCGCCAAGGTGAGCGTCGTCGCGGGCGACGTCACCGAC
CGGGCGACGATGGCCGAACTGCTCGCCGGCCTGCCCGCCGACCTGCCGCTGCGGTCGGTG
TTCCACACCGCCGGCGTCCTGCACGAGCCGACACCCGTCGAGGCGCTCAGCCTGGAGACG
CTGCACGACAGTCTCGGGGCGAAGGTCGAAGGCGCCCTGCTGCTGGACGAGTTGACCGGC
GAGACGGACCTGGACGCGTTCGTGCTGTTCTCGTCGGGCGCGGCGTCCTGGGGCGGCAGC
GGCCAGGGCGGTTACGCGGCGGGCAACGCCTGCCTGGACAGCCTCGCGGAGTACCGCCGG
GCCCGCGGGCGTACCGCCACCTCCATCGCCTGGGGCACCTGGGCCGAGGCGGGGATGGCC
GCGGCGAACACCGACGAGCACGACTACCTGGTGCGGCTGGGCGTGCTGCCCATGCAGCCC
GAACCGGCCGTCGCCGCCATGCAGCGCGTCCTGGAGGAGGACGCGACCACGGTCACCGTC
TCCGACATGGACTGGTCGAGGTTCGCGCCCGCGTTCTCGCTGGCCCGGCCGAGCCGGCTG
CTCGCCCTGCTCCAGGACACCGGCCCCGCCGCGGCCGAACCCGAGGCCGACGCCACCGCG
TTCGCCGGGCAGTTGGCGGCGGTGCCCGCGGCCGAGCGGCGCGAGTACCTCGTCACCCTG
GTGTGCGACCACGCCGCCGCCGTGCTGGGCCACGGCAGTGGCGACGAACTGGACCCCGAG
ACCGCCTTCCGGGACGCCGGGTTCGACTCGCTGACCGCGGTCGAACTGCGCGACCGGCTC
CAGGCGATGACCGGGCTGACCCTGCCCGCCACGCTCGTCTTCGACTACCCCAACCCGCTC
AAGCTCGCGGCCCTGCTGGACGAGACGGCCGGCGGCACCGCGGGGGAGGGCGACGAGGAG
GAGCTGCGCCGCGTGCTGGCGTCCGTCCCGCCGGCCAAACTCCGGGCCGCCGGCCTGCTC
GACGCCGTCCTCGCCCTGGCCGAGGAGGCGGGCCAGGACACCGGCGAGGCGGACGGGGCC
GACGAGCCGGACGAGACCGACCTGATGACCGCCGACGCCGACGACCTCGTCCGCATCGCG
CTCGGATCCGCGTGA
[7] KS34..408
[7] AT601..914
[7] methylmalonyl-CoA790..794
[7] DH962..1127
[7] ER1456..1762
[7] KR1772..1952
[7] ACP2049..2123
[8] KS2147..2519
[8] AT2705..3010
[8] malonyl-CoA2890..2894
[8] KR3297..3477
[8] ACP3573..3647
[7] KS100..1224
[7] AT1801..2742
[7] methylmalonyl-CoA2368..2382
[7] DH2884..3381
[7] ER4366..5286
[7] KR5314..5856
[7] ACP6145..6369
[8] KS6439..7557
[8] AT8113..9030
[8] malonyl-CoA8668..8682
[8] KR9889..10431
[8] ACP10717..10941

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [593-721]  G3DSA:3.40.366.10 [790-902]  G3DSA:3.40.366.10 [2692-2825]  G3DSA:3.40.366.10 [2890-2981]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2081-2096]  PS00012 [3605-3620]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2057-2122]  7.7e-10 PF00550 [3581-3646]  3.1e-11 PF00550
PF00550   PP-binding
 [2046-2163]  3.30000526807186e-26 SSF47336 [3569-3656]  4.60000044330862e-21 SSF47336
SSF47336   ACP_like
 [2049-2123]  PS50075 [3573-3647]  PS50075
PS50075   ACP_DOMAIN
 [2051-2127]  8.30000000000004e-41 G3DSA:1.10.1200.10 [3575-3649]  8.30000000000004e-41 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1450-1602]  3.39999972437719e-34 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1595-1686]  7.90000000000001e-16 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1476-1532]  2e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1772-1950]  1.99999999999999e-59 PF08659 [3297-3476]  3.89999999999997e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-282]  1.10000000000001e-89 PF00109 [2147-2396]  3.60000000000002e-92 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [290-408]  3.8e-46 PF02801 [2404-2519]  5.89999999999994e-44 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [601-914]  1.60000000000002e-104 PF00698 [2705-3010]  3.2e-61 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [599-888]  2.80000504261099e-68 SSF52151 [2702-3003]  9.80000272130214e-70 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [724-789]  4.90001027782405e-21 SSF55048 [2827-2889]  3.70000251046782e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [34-293]  G3DSA:3.40.47.10 [296-459]  3.49999999999995e-126 G3DSA:3.40.47.10 [2146-2406]  G3DSA:3.40.47.10 [2410-2574]  3.49999999999995e-126 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-406]  3.10001307370203e-101 SSF53901 [2139-2574]  8.89993011983204e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1592-1685]  2.2e-18 G3DSA:3.40.50.720 [1773-1989]  4.2e-68 G3DSA:3.40.50.720 [3295-3521]  4.2e-68 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [195-211]  PS00606 [2309-2325]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [603-895]  1.50000965748778e-119 SM00827 [2705-2990]  3.699978135861e-113 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2054-2126]  2.19999900980708e-32 SM00823 [3578-3650]  2.10000267834031e-30 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [962-1127]  2.80000504261099e-79 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-460]  SM00825 [2149-2574]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1772-1952]  1.10000150671643e-55 SM00822 [3297-3477]  7.40000780398343e-48 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1456-1762]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit