close all open/close all

CDS information : Rever_00130


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction39,521 / 40,624 / + [in whole cluster]
39,521 / 40,624 / + [in contig]
Location39521..40624 [in whole cluster]
39521..40624 [in contig]
TypeCDS
Length1,104 bp (367 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aryl-alcohol dehydrogenase
putative benzyl alcohol dehydrogenase
Product (GenBank)putative dehydrogenase
Gene
Gene (GenBank)revE
EC number1.1.1.90
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
P39849
PmId
[8496150] Kinetic studies on benzyl alcohol dehydrogenase encoded by TOL plasmid pWWO. A member of the zinc-containing long chain alcohol dehydrogenase family. (J Biol Chem. , 1993)
ACC
Q2Z1W5
PmId
[16292529] Characterization of four Rhodococcus alcohol dehydrogenase genes responsible for the oxidation of aromatic alcohols. (Appl Microbiol Biotechnol. , 2006)

close this sectionSequence

selected fasta
>putative aryl-alcohol dehydrogenase [putative dehydrogenase]
MDITAAVIEEAGSPFVLKQVELADPGPDEVLVELHATGLCHTDLAVQHGFTPFPLPGVLG
HEGSGVVRAVGPGVLGLAAGDHVALSFASCGECGNCRDKVPSYCDTFVARNFMGARIDGT
RPLSLDGAGLGSNFFGQSSFASHTVAHTRSVVKIPAEVPLPLAAPLGCGVQTGAGAVLNS
LQVTAGSSVLVLGGGSVGLSAVMGAVLAGAETVIVVEPLESRRLVAKDLGATHVLDPEDG
GIAEQVRGIVPQGVRYAVDTTAKSAVLAEVVQAMAKRGRVALLGIPSEPTAVLPLSLGLS
QILGLSVVGVVEGDSDPHTFIPWLLDQYLQGRFPLDRLVTTLPFADINEAAAAQVRGDAI
KVVLTHR
selected fasta
>putative aryl-alcohol dehydrogenase [putative dehydrogenase]
ATGGACATCACCGCAGCAGTGATCGAGGAGGCCGGGTCCCCCTTCGTCCTGAAGCAGGTC
GAACTGGCCGACCCCGGCCCGGACGAGGTGCTGGTCGAGCTGCACGCCACCGGGCTGTGC
CACACCGACCTGGCCGTCCAGCACGGGTTCACGCCCTTCCCGCTGCCCGGCGTGCTGGGC
CACGAGGGCAGCGGCGTGGTGCGCGCGGTGGGGCCGGGCGTCCTCGGCCTCGCGGCCGGC
GACCACGTGGCGCTGTCGTTCGCGAGCTGCGGCGAGTGCGGCAACTGCCGGGACAAGGTG
CCCTCCTACTGCGACACCTTCGTCGCCCGGAACTTCATGGGCGCCCGCATCGACGGCACC
CGGCCGCTGTCGCTGGACGGCGCGGGACTCGGCTCGAACTTCTTCGGCCAGTCGAGCTTC
GCCTCGCACACCGTGGCGCACACCCGCTCCGTGGTGAAGATCCCCGCCGAGGTCCCGCTG
CCGCTGGCCGCGCCCCTGGGCTGCGGTGTGCAGACCGGCGCCGGGGCGGTGCTCAACTCG
CTCCAGGTCACCGCGGGCAGCTCGGTGCTGGTGCTCGGCGGCGGCTCGGTCGGCCTCAGC
GCCGTGATGGGCGCGGTGCTCGCCGGCGCCGAGACCGTCATCGTCGTCGAGCCGCTGGAG
TCGCGGCGGCTGGTCGCCAAGGACCTCGGCGCGACCCACGTCCTGGACCCCGAGGACGGC
GGGATCGCCGAGCAGGTCCGCGGCATCGTGCCGCAGGGCGTGCGGTACGCGGTGGACACC
ACCGCCAAGTCCGCGGTGCTCGCCGAGGTCGTCCAGGCCATGGCCAAGCGGGGCCGCGTC
GCCCTGCTGGGCATCCCCTCCGAACCCACCGCCGTGCTCCCGCTGAGCCTCGGGCTGAGC
CAGATCCTCGGGCTGAGCGTCGTCGGCGTCGTCGAGGGCGACAGCGACCCGCACACGTTC
ATCCCCTGGCTGCTCGACCAGTACCTCCAGGGCCGGTTCCCCCTCGACCGCCTCGTCACC
ACGCTGCCGTTCGCCGACATCAACGAGGCGGCCGCGGCGCAGGTGCGCGGGGACGCGATC
AAGGTGGTGCTCACGCACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002328 Alcohol dehydrogenase, zinc-type, conserved site (Conserved_site)
 [60-74]  PS00059
PS00059   ADH_ZINC
IPR011032 GroES-like (Domain)
 [1-192]  3.10001307370203e-69 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [197-325]  3.7e-19 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [27-121]  1.9e-22 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [189-290]  2.1e-28 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-23]  0.131 Signal
Bacteria, Gram-positive   
TMHMM No significant hit