close all open/close all

CDS information : Rever_00140


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction40,693 / 42,144 / + [in whole cluster]
40,693 / 42,144 / + [in contig]
Location40693..42144 [in whole cluster]
40693..42144 [in contig]
TypeCDS
Length1,452 bp (483 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aldehyde dehydrogenase
Product (GenBank)putative aldehyde dehydrogenase
Gene
Gene (GenBank)revF
EC number1.2.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
O33455
PmId
[9150211] p-Cymene catabolic pathway in Pseudomonas putida F1: cloning and characterization of DNA encoding conversion of p-cymene to p-cumate. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative aldehyde dehydrogenase [putative aldehyde dehydrogenase]
MPIDHHHFYIGGDRVAPGTGHRIQVHAAATGELVGSVPEAHPADVDAAVAAARAAFDDPS
GWRQWTPQARAETLTRFAAALKERAPEIARLVSVQNGMPISLAGLLEGTAPSALLRYYAA
VAAAKTGDDRRPGLFGGHAVVVPEPVGVVAAIVPWNVPQGITFMKLAPALAAGCSVVLKP
SPETVLDAYQVAEAAAEAGLPAGLLNIVPGGAETGRYLVGHPGVDKVSFTGSTATGRSIA
ETCGRLLRPVSLELGGKSAAVVLDDADLSGVMDRFFRATLLNNGQVCWLGTRILAPRSRY
AELVDAVTEMARALKVGDPLDPATQLGPLVSERQRDRVESYIAKGVSDGARLTVGGGRPA
WADRGWYVDATVFADVDNRSAIAQEEIFGPVLSVIPYTDEDEALALANDSDYGLGGSVWT
TDADRGLDFARRVQTGSIGVNSYANDPVAPFGGRKASGLGYELGPEGLAQYQVLKSIYVD
QQV
selected fasta
>putative aldehyde dehydrogenase [putative aldehyde dehydrogenase]
ATGCCCATCGACCACCACCACTTCTACATCGGCGGCGACCGGGTCGCACCCGGCACCGGG
CACCGCATCCAGGTGCACGCCGCCGCCACCGGAGAACTCGTCGGCAGCGTGCCGGAGGCC
CACCCGGCGGACGTGGACGCGGCCGTCGCCGCCGCCCGCGCCGCCTTCGACGACCCCTCG
GGGTGGCGGCAGTGGACCCCGCAGGCCCGCGCGGAGACGCTGACCCGTTTCGCGGCGGCT
CTCAAGGAGCGTGCTCCCGAGATCGCCCGGCTGGTCAGCGTGCAGAACGGCATGCCGATC
AGCCTGGCCGGCCTGCTGGAGGGCACCGCGCCCTCGGCGCTGCTGCGCTACTACGCCGCG
GTGGCCGCCGCGAAGACGGGCGACGACCGCCGCCCCGGCCTGTTCGGCGGGCACGCGGTC
GTCGTCCCCGAACCGGTGGGCGTCGTCGCCGCGATCGTCCCCTGGAACGTGCCCCAGGGC
ATCACCTTCATGAAGCTCGCCCCCGCCCTGGCCGCGGGCTGCTCCGTGGTGCTCAAGCCG
TCCCCGGAGACCGTGCTCGACGCCTACCAGGTCGCCGAGGCCGCCGCGGAGGCCGGACTG
CCCGCGGGGCTGCTCAACATCGTGCCCGGCGGCGCGGAGACCGGCCGCTACCTCGTCGGC
CACCCCGGCGTGGACAAGGTGTCCTTCACCGGCTCCACCGCCACCGGCCGGAGCATCGCC
GAGACCTGCGGGCGGCTGCTGCGGCCGGTCTCCCTGGAGCTGGGCGGCAAGTCCGCCGCG
GTCGTCCTGGACGACGCGGACCTCAGCGGCGTGATGGACCGCTTCTTCCGGGCCACGCTG
CTGAACAACGGGCAGGTCTGCTGGCTGGGCACCAGGATCCTGGCGCCCCGCTCCCGCTAC
GCCGAACTGGTCGACGCCGTCACCGAGATGGCGCGCGCGCTCAAGGTCGGCGACCCGCTC
GACCCCGCGACCCAGCTCGGCCCGCTGGTCTCCGAGCGGCAGCGGGACCGGGTGGAGTCC
TACATCGCCAAGGGCGTCAGCGACGGCGCCCGCCTCACCGTCGGCGGCGGCCGCCCCGCG
TGGGCCGACCGCGGCTGGTACGTCGACGCGACCGTCTTCGCCGACGTGGACAACAGGTCC
GCCATCGCGCAGGAGGAGATCTTCGGCCCGGTGCTGTCGGTCATCCCCTACACCGACGAG
GACGAGGCCCTGGCACTCGCCAACGACAGCGACTACGGGCTCGGCGGCTCGGTGTGGACC
ACCGACGCCGACCGCGGCCTGGACTTCGCCCGCCGGGTGCAGACCGGCTCGATCGGGGTC
AACAGCTACGCCAACGACCCGGTCGCGCCCTTCGGGGGCCGCAAGGCGAGCGGCCTCGGC
TACGAACTGGGCCCCGAGGGCCTCGCCCAGTACCAGGTCCTGAAGTCGATCTACGTCGAC
CAGCAGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR015590 Aldehyde dehydrogenase domain (Domain)
 [20-477]  PF00171
PF00171   Aldedh
IPR016160 Aldehyde dehydrogenase, conserved site (Conserved_site)
 [252-259]  PS00687
PS00687   ALDEHYDE_DEHYDR_GLU
IPR016161 Aldehyde/histidinol dehydrogenase (Domain)
 [1-480]  SSF53720
SSF53720   Aldehyde_DH/Histidinol_DH
IPR016162 Aldehyde dehydrogenase, N-terminal (Domain)
 [5-264]  1e-84 G3DSA:3.40.605.10
G3DSA:3.40.605.10   Aldehyde_dehydrogenase_N
IPR016163 Aldehyde dehydrogenase, C-terminal (Domain)
 [265-452]  3.30000000000002e-65 G3DSA:3.40.309.10
G3DSA:3.40.309.10   Aldehyde_dehydrogenase_C
SignalP
 [1-27]  0.162 Signal
Bacteria, Gram-negative   
TMHMM No significant hit