close all open/close all

CDS information : Rever_00150


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction42,227 / 43,048 / + [in whole cluster]
42,227 / 43,048 / + [in contig]
Location42227..43048 [in whole cluster]
42227..43048 [in contig]
TypeCDS
Length822 bp (273 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductNAD(+)-dependent reveromycin A1a dehydrogenase
Product (GenBank)dihydroxy ketone synthase
Gene
Gene (GenBank)revG
EC number1.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>NAD(+)-dependent reveromycin A1a dehydrogenase [dihydroxy ketone synthase]
MTRRLDGKVAMITGAARGQGRGHALRLAEEGADLILVDICQNIDTLAYSLGSEDELAETA
AQVEKLGRRVVTAQADTRDAAALREAVERGTSELGGLDILVANAGVGMAHPSTSQEQAFR
DQLEINTIGAWNTVHAAAPKIIEGGKGGAVVVISSVMGLSGKIGSPTGGAEGYVAAKHAL
LGLSRAWTRWLGPHNIRVNSIHTTGVRTPLLINDAVKKVHTKPPTTGAEVGHILDVTMLD
VSDVTGAVSWLVSDEARYVTGIALPIDAGFTTP
selected fasta
>NAD(+)-dependent reveromycin A1a dehydrogenase [dihydroxy ketone synthase]
ATGACGCGACGACTCGACGGTAAGGTGGCCATGATCACGGGTGCGGCCCGTGGCCAGGGC
CGGGGCCACGCCCTGCGGCTGGCCGAGGAGGGCGCCGACCTGATCCTGGTGGACATCTGC
CAGAACATCGACACGCTGGCCTACTCCCTCGGCTCCGAGGACGAGCTCGCCGAGACCGCC
GCCCAGGTGGAGAAGCTGGGCCGCCGCGTGGTGACGGCGCAGGCCGACACCCGGGACGCG
GCGGCGCTGCGGGAGGCCGTCGAGCGCGGCACCTCGGAGCTGGGCGGCCTGGACATCCTC
GTCGCCAACGCCGGCGTGGGCATGGCGCACCCCTCGACCAGCCAGGAGCAGGCGTTCCGC
GACCAGTTGGAGATCAACACCATCGGCGCATGGAACACCGTGCACGCCGCGGCGCCGAAG
ATCATCGAGGGCGGCAAGGGCGGCGCGGTCGTCGTCATCAGCTCGGTGATGGGCCTGAGC
GGCAAGATCGGCAGCCCGACCGGCGGCGCGGAGGGCTACGTCGCCGCCAAGCACGCGCTG
CTGGGCCTGTCCCGGGCGTGGACCCGGTGGCTGGGCCCGCACAACATCCGGGTCAACTCC
ATCCACACCACCGGGGTGCGCACCCCGCTGCTCATCAACGACGCCGTCAAGAAGGTGCAC
ACCAAGCCCCCCACCACCGGCGCCGAGGTGGGCCACATCCTCGACGTCACGATGCTGGAC
GTCAGCGACGTCACCGGCGCGGTGTCCTGGCTGGTCTCGGACGAGGCCCGCTACGTCACC
GGTATCGCGCTGCCGATCGACGCCGGCTTCACCACCCCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [95-106]  1.79999951654677e-06 PR00080 [148-156]  1.79999951654677e-06 PR00080 [173-192]  1.79999951654677e-06 PR00080
PR00080   SDRFAMILY
 [8-187]  1.4e-23 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  1.10000150671642e-21 PR00081 [95-106]  1.10000150671642e-21 PR00081 [142-158]  1.10000150671642e-21 PR00081 [173-192]  1.10000150671642e-21 PR00081 [194-211]  1.10000150671642e-21 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [1-271]  1.99999999999999e-61 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-24]  0.106 Signal
Bacteria, Gram-negative   
TMHMM No significant hit