close all open/close all

CDS information : Rever_00160


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction44,641 / 43,118 / - [in whole cluster]
44,641 / 43,118 / - [in contig]
Locationcomplement(43118..44641) [in whole cluster]
complement(43118..44641) [in contig]
TypeCDS
Length1,524 bp (507 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative FAD dependent oxidoreductase
Gene
Gene (GenBank)revH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>hypothetical protein [putative FAD dependent oxidoreductase]
MAEHVDVLVVGAGLSGIGAAGRLRRADPRRTLAILEARDAVGGTWDLFRYPGVRSDSDMH
TLGYQQRPWKDPKAIADGESILSYIRETAREDGLLDHVRFRHRVVGADWDEAHARWNVRV
ERGAEGEAEEITLTCSFLYLCSGYYRYDEGYSPQFKDADRFGGRIVHPQHWPADLDYTGK
RVVVIGSGATAVTLVPAMAARAAHVTMLQRSPSYVMSLPSRDGIAGALRRVLPERTALAA
IRWKNATLALGFYRFSRKRPEKVKAMLRKGVVKQLPDGYDVDTHFTPRYAPWDQRVCYVP
DGDLFKAISAGEASVVTDHVESFTERGLLLRSGKEVPADVVVTATGLNLLPLGGIRLSVA
GRPVDPGATVAYKGMMLSGVPNFAWTLGYTNSSWTLKADLVAQYVSRLLAHMAERGHAVV
RPLAPPAGDEVLPILDLRSGYVLRGADTMPKRGTRAPWTLEQNYRQDVRLLWRGPVDDAV
EFAPAPSGARAAGSGDAPARPVPETSS
selected fasta
>hypothetical protein [putative FAD dependent oxidoreductase]
GTGGCTGAGCACGTCGATGTCCTCGTCGTCGGGGCGGGACTGTCCGGGATCGGCGCCGCC
GGCCGGTTGCGGCGCGCGGACCCGCGGCGGACGCTGGCGATCCTGGAGGCGCGGGACGCC
GTCGGCGGGACGTGGGACCTGTTCCGGTACCCGGGGGTGCGGTCGGACTCGGACATGCAC
ACCCTGGGCTACCAGCAGCGCCCGTGGAAGGACCCGAAGGCGATCGCCGACGGGGAGAGC
ATCCTGTCCTACATCCGGGAGACCGCCCGGGAGGACGGCCTGCTGGACCACGTCCGCTTC
CGGCACCGGGTGGTCGGCGCGGACTGGGACGAGGCGCACGCCCGCTGGAACGTGCGGGTG
GAGCGGGGCGCGGAGGGCGAGGCCGAGGAGATCACGCTGACCTGCTCCTTCCTCTACCTG
TGCTCGGGCTACTACCGCTACGACGAGGGCTACAGCCCGCAGTTCAAGGACGCCGACCGG
TTCGGGGGGCGGATCGTGCACCCCCAGCACTGGCCCGCGGACCTGGACTACACCGGCAAG
CGCGTCGTCGTCATCGGCAGCGGCGCCACGGCGGTCACCCTGGTGCCCGCGATGGCCGCA
CGGGCCGCGCACGTCACGATGCTCCAGCGCTCGCCCTCCTACGTGATGTCGCTGCCCTCC
CGGGACGGCATCGCGGGCGCGCTGCGCCGGGTGCTGCCCGAGCGCACCGCGCTGGCCGCG
ATCCGGTGGAAGAACGCGACGCTGGCGCTGGGCTTCTACCGGTTCAGCCGCAAGCGCCCC
GAGAAGGTGAAGGCGATGCTGCGCAAGGGCGTCGTCAAGCAGCTCCCGGACGGCTACGAC
GTCGACACCCACTTCACCCCGCGGTACGCGCCGTGGGACCAGCGGGTGTGCTACGTGCCG
GACGGGGACCTGTTCAAGGCGATCAGCGCCGGGGAGGCGTCGGTCGTCACCGACCACGTG
GAGTCCTTCACCGAGAGGGGCCTCCTGCTGCGCTCGGGCAAGGAGGTGCCCGCGGACGTG
GTCGTCACGGCGACCGGTCTGAACCTGCTGCCGCTTGGCGGCATCCGGCTGAGCGTGGCC
GGCCGGCCGGTCGACCCGGGCGCGACGGTCGCCTACAAGGGCATGATGCTCTCCGGGGTG
CCGAACTTCGCCTGGACGCTGGGCTACACCAACAGCTCGTGGACGCTGAAGGCCGACCTC
GTCGCGCAGTACGTGTCCCGGCTGCTGGCGCACATGGCCGAGCGCGGCCACGCCGTGGTG
CGGCCGCTGGCCCCGCCGGCCGGGGACGAAGTGCTGCCGATCCTGGACCTGCGGTCCGGC
TACGTGCTGCGCGGCGCGGACACCATGCCGAAGCGGGGCACGCGCGCGCCGTGGACCCTG
GAGCAGAACTACCGGCAGGACGTCCGGCTGCTTTGGCGCGGTCCGGTGGACGACGCCGTG
GAGTTCGCCCCGGCGCCCTCCGGCGCCCGGGCCGCCGGCTCCGGGGACGCCCCGGCGCGT
CCGGTGCCGGAGACGAGTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-20]  0.5 Signal
Eukaryota   
TMHMM No significant hit