close all open/close all

CDS information : Rever_00170


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction45,877 / 44,684 / - [in whole cluster]
45,877 / 44,684 / - [in contig]
Locationcomplement(44684..45877) [in whole cluster]
complement(44684..45877) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)putative monooxygenase
Gene
Gene (GenBank)revI
EC number
Keyword
  • C-18 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
[25258320] Structure-function analyses of cytochrome P450revI involved in reveromycin A biosynthesis and evaluation of the biological activity of its substrate, reveromycin T. (J Biol Chem. , 2014)

close this sectionSequence

selected fasta
>cytochrome P450 [putative monooxygenase]
MNTTYPESLSYPFGPDEGLALSESYTRARDTDGLIRVKLPYGEPAWLATRYEDARLVLGD
ARFSRALSEEHDPPRARKFNAQAKSMFNMDAPDHTRLRRLISKAFTIRRVEELRPKVHDL
AHRLIDDMLAKGEPADLVADYALPIPTTVICELLGVPFEDREKFGRWTDAILSTSTLNPE
EGRVKRMELVGYIGGIIAARRAQPADDLISGMIEARDVQDKLTEQELLDHCIGLLIAGHE
TTASQIPSFVYALLDQPQHWKRLLDDPELIPSAVEELFRFVPLGSGSAAPRYAREDIEVG
GTLVRAGEPVLVALGAANRDGLRFEDPEEIKLDRPSNHHIGFGHGIHHCLGAPLARLELQ
EALRALLERLPTLKVAGDIAWKSEMMVRGPRSMPVGW
selected fasta
>cytochrome P450 [putative monooxygenase]
TTGAACACGACCTACCCGGAGTCGCTGTCCTACCCGTTCGGCCCTGACGAAGGTCTCGCG
CTGAGCGAGTCGTACACCAGGGCGCGCGACACCGACGGCCTGATCCGCGTCAAGCTGCCC
TACGGAGAACCGGCCTGGCTGGCCACCCGCTACGAGGACGCCCGGCTCGTGCTGGGCGAC
GCGCGCTTCAGCCGCGCGCTGTCCGAGGAGCACGACCCGCCGCGGGCACGGAAGTTCAAC
GCGCAGGCGAAGTCCATGTTCAACATGGACGCGCCCGACCACACCCGGCTGCGCCGGCTG
ATCAGCAAGGCGTTCACCATCCGCCGGGTGGAGGAGCTGCGGCCGAAGGTCCACGACCTG
GCCCACCGGCTCATCGACGACATGCTGGCCAAGGGCGAGCCGGCGGACCTGGTGGCGGAC
TACGCGCTGCCGATCCCGACGACCGTCATCTGCGAGCTGCTCGGCGTCCCCTTCGAGGAC
CGGGAGAAGTTCGGCAGGTGGACCGACGCCATCCTGTCGACCAGCACGCTGAACCCCGAG
GAGGGCCGGGTCAAGCGCATGGAGCTGGTCGGCTACATCGGCGGGATCATCGCGGCCCGC
CGCGCACAGCCGGCCGACGACCTCATCTCGGGCATGATCGAGGCCCGCGACGTGCAGGAC
AAGCTCACCGAGCAGGAGTTGCTGGACCACTGCATCGGCCTGCTCATCGCCGGGCACGAG
ACCACCGCCTCCCAGATCCCCAGCTTCGTCTACGCCCTGCTGGACCAGCCGCAGCACTGG
AAGCGGCTGCTGGACGACCCGGAGCTGATCCCGTCGGCCGTCGAGGAGCTGTTCCGCTTC
GTGCCGCTGGGCAGCGGCTCGGCCGCCCCGCGCTACGCCCGGGAGGACATCGAGGTCGGC
GGGACGCTGGTGCGCGCCGGCGAACCGGTCCTGGTGGCCCTCGGCGCGGCCAACCGCGAC
GGGCTGCGCTTCGAGGACCCCGAGGAGATCAAGCTCGACCGCCCGAGCAACCACCACATC
GGCTTCGGCCACGGCATCCACCACTGCCTCGGCGCCCCGCTGGCCCGGCTGGAGTTGCAG
GAGGCGCTGCGCGCGCTCCTGGAGCGGCTGCCGACCCTCAAGGTGGCGGGCGACATCGCC
TGGAAGAGCGAGATGATGGTCCGCGGTCCGCGGTCCATGCCGGTGGGATGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [237-254]  2.90000036269908e-07 PR00385 [272-283]  2.90000036269908e-07 PR00385 [340-349]  2.90000036269908e-07 PR00385 [349-360]  2.90000036269908e-07 PR00385
PR00385   P450
 [42-369]  5.69999999999998e-24 PF00067
PF00067   p450
 [8-397]  7.19996395544006e-100 SSF48264
SSF48264   Cytochrome_P450
 [12-397]  2.09999999999996e-113 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [89-100]  1.20000117458134e-60 PR00359 [136-152]  1.20000117458134e-60 PR00359 [153-168]  1.20000117458134e-60 PR00359 [191-213]  1.20000117458134e-60 PR00359 [272-283]  1.20000117458134e-60 PR00359 [291-318]  1.20000117458134e-60 PR00359 [319-334]  1.20000117458134e-60 PR00359 [340-349]  1.20000117458134e-60 PR00359 [349-360]  1.20000117458134e-60 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [342-351]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-28]  0.058 Signal
Bacteria, Gram-negative   
TMHMM No significant hit