close all open/close all

CDS information : Rever_00180


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction46,954 / 45,944 / - [in whole cluster]
46,954 / 45,944 / - [in contig]
Locationcomplement(45944..46954) [in whole cluster]
complement(45944..46954) [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)spiroacetal synthase
Gene
Gene (GenBank)revJ
EC number
Keyword
  • spiroketal moiety
  • C-15 S-stereochemistry
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>cyclase/dehydratase [spiroacetal synthase]
MTETEQLDVPHVEVTIPVGEGPSAVALTPDGTRAYVTNYGRWATHSPGDTVSVIDTATHE
VVATVKVGVGPTALEVVPDGSRVYVVNYGSGKEPGHTVSVIDTATHEVVATVEVGNSPDG
VAVTPDGRRVYISELGSEANPGNTMSVIDTATFEVVGTVDVGAAPGAVAIHEDGVHAYVV
NYGKPTETEGTVSVIDIATNTVVTTVTVGRSPGAVAITPDGAHAYVADHGPFGDPGNTVS
VIDTRTHEVASVITVGPGPGGVAISPDGTRAYVVNMGGNTAPGRTMSVIDTATRTVVNTV
AVERTPAGIAVSADGRRAYIANYGANLVSVVDLTRV
selected fasta
>cyclase/dehydratase [spiroacetal synthase]
GTGACCGAGACCGAACAGCTCGACGTCCCGCACGTGGAGGTCACCATCCCGGTGGGCGAG
GGGCCCTCCGCGGTCGCCCTCACCCCGGACGGCACCCGGGCGTACGTGACGAACTACGGG
CGGTGGGCGACCCACTCCCCCGGTGACACGGTGTCGGTGATCGACACCGCCACCCACGAG
GTCGTCGCGACCGTGAAGGTCGGCGTCGGGCCCACCGCGCTGGAGGTCGTCCCCGACGGC
TCCCGGGTCTACGTCGTCAACTACGGCTCCGGCAAGGAGCCGGGCCACACCGTCTCGGTC
ATCGACACCGCCACCCACGAGGTCGTGGCCACCGTCGAGGTCGGCAACTCCCCCGACGGC
GTCGCGGTCACGCCCGACGGCCGGCGGGTCTACATCTCCGAACTGGGCTCCGAGGCCAAC
CCCGGCAACACCATGTCGGTCATCGACACCGCCACCTTCGAGGTGGTCGGCACCGTCGAC
GTGGGGGCGGCGCCCGGCGCGGTGGCGATCCACGAGGACGGCGTGCACGCCTACGTGGTC
AACTACGGCAAGCCGACCGAGACCGAGGGCACCGTCTCCGTCATCGACATCGCGACGAAC
ACGGTGGTCACCACCGTGACCGTGGGCCGGTCGCCCGGCGCCGTCGCCATCACCCCGGAC
GGCGCCCACGCCTACGTCGCCGACCACGGACCGTTCGGCGACCCCGGGAACACGGTGTCG
GTCATCGACACCCGCACCCACGAGGTGGCGTCCGTCATCACGGTCGGCCCCGGCCCCGGC
GGGGTGGCGATCTCCCCCGACGGCACCCGCGCCTACGTCGTGAACATGGGTGGCAACACG
GCCCCCGGCAGGACGATGTCCGTGATCGACACCGCCACGCGGACGGTCGTCAACACCGTC
GCCGTCGAGCGCACTCCCGCCGGCATCGCCGTGTCCGCGGACGGCCGCCGGGCCTACATC
GCGAACTACGGCGCCAACCTCGTGTCCGTCGTCGACCTCACCCGGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011045 Nitrous oxide reductase, N-terminal (Domain)
 [22-332]  3.10001307370203e-65 SSF50974
SSF50974   N2O_reductase_N
IPR011964 YVTN beta-propeller repeat (Repeat)
 [29-72]  2.9e-09 TIGR02276 [78-124]  3.1e-12 TIGR02276 [125-170]  1.9e-07 TIGR02276 [219-265]  2e-09 TIGR02276 [266-312]  3.90000000000001e-10 TIGR02276
TIGR02276   Beta_rpt_yvtn
IPR015943 WD40/YVTN repeat-like-containing domain (Domain)
 [15-89]  2.20000000000002e-90 G3DSA:2.130.10.10 [93-334]  2.20000000000002e-90 G3DSA:2.130.10.10
G3DSA:2.130.10.10   WD40/YVTN_repeat-like
IPR019405 Lactonase, 7-bladed beta propeller (Family)
 [103-224]  2.2e-05 PF10282 [245-333]  4e-05 PF10282
PF10282   Lactonase
SignalP
 [1-34]  0.081 Signal
Bacteria, Gram-negative   
TMHMM No significant hit