close all open/close all

CDS information : Rever_00190


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction47,347 / 48,279 / + [in whole cluster]
47,347 / 48,279 / + [in contig]
Location47347..48279 [in whole cluster]
47347..48279 [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative malonyl transferase
Gene
Gene (GenBank)revK
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>hypothetical protein [putative malonyl transferase]
MKIAYLVDGGLSDLPGAGTDLYERYPQVQEIYEKAAGWTGLTVDRMLRWELDRLEEYQQV
GLIRQASIILGVADLLAERGVRPDVIAGMSLGSLVGACIAGAVERKDLFTFLRRKTEVPP
PTGPAQGCAGLLVPVDADDEEYLGQLVEGTWVGGELGLRRNGTVRGFMVSGYVDALHELM
AKLPEGSMHMIKDVNVAVHVPACADQNEYLEPVWSKMNFHDPEIPLCSCKERGMLTTAAD
VRKWYLGNQVDKVSHPDMFSNVIGHEPQLAFLLGPAKLDIYLDALPCPVIQIENDEQLTD
AMTALYEMRI
selected fasta
>hypothetical protein [putative malonyl transferase]
GTGAAGATCGCATACCTTGTCGATGGGGGTCTGAGCGATCTGCCAGGCGCCGGCACGGAT
CTCTACGAGCGCTACCCGCAGGTCCAGGAGATCTACGAGAAGGCCGCCGGCTGGACCGGG
CTGACCGTCGACCGGATGCTGCGCTGGGAACTGGACCGCCTGGAGGAGTACCAGCAGGTC
GGGCTGATCCGCCAGGCCTCGATCATCCTCGGCGTCGCCGACCTGCTCGCCGAGCGCGGC
GTGCGCCCCGACGTCATCGCCGGCATGAGCCTCGGCTCGCTGGTGGGCGCCTGCATCGCG
GGCGCCGTCGAGCGCAAGGACCTGTTCACCTTCCTGCGCCGGAAGACCGAGGTGCCCCCG
CCCACCGGCCCCGCCCAGGGATGCGCCGGCCTGCTGGTGCCGGTGGACGCCGACGACGAG
GAGTACCTCGGCCAGCTCGTCGAGGGCACCTGGGTCGGCGGCGAGCTCGGCCTGCGCCGC
AACGGCACCGTCCGCGGCTTCATGGTCTCCGGGTACGTCGACGCCCTCCACGAGCTGATG
GCCAAGCTCCCGGAGGGGTCGATGCACATGATCAAGGACGTGAACGTCGCCGTGCACGTC
CCCGCCTGCGCCGACCAGAACGAATACCTCGAACCGGTCTGGTCGAAGATGAATTTCCAC
GACCCGGAGATTCCGCTGTGTTCCTGCAAGGAGCGCGGAATGCTCACCACCGCGGCGGAC
GTACGGAAATGGTACCTGGGAAACCAGGTCGACAAGGTGAGCCATCCCGACATGTTCTCC
AACGTGATCGGCCACGAACCCCAGCTTGCGTTCCTCCTCGGCCCGGCCAAGCTCGACATC
TACCTCGACGCACTGCCGTGCCCGGTCATTCAGATCGAGAACGACGAACAGCTCACGGAC
GCCATGACCGCCCTGTACGAAATGCGGATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [13-119]  1e-15 G3DSA:3.40.366.10 [193-277]  1e-15 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [2-277]  2.49999811956465e-16 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
SignalP No significant hit
TMHMM No significant hit