close all open/close all

CDS information : Rever_00210


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction49,561 / 50,523 / + [in whole cluster]
49,561 / 50,523 / + [in contig]
Location49561..50523 [in whole cluster]
49561..50523 [in contig]
TypeCDS
Length963 bp (320 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative quinone oxidoreductase
Gene
Gene (GenBank)revM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Family/Domain
FD
IPR013154, IPR013149

close this sectionSequence

selected fasta
>putative oxidoreductase [putative quinone oxidoreductase]
MQAIVIEDKQLVLREVEDPRPGPGEVVVDVAAAGVNRADVSQRQGLYPPPPGAAPYPGLE
VSGVVSALGIGVKGRRVGDEVACLLAGGGYAERVAVPAAHTLPVPAGVSLRDAAALPEVA
CTVWSNVVDRDALREGETLLVHGGGSGIGTFAIQLGKALGASVVVTARAAKHDRLRALGA
DLAVDYTTEDFVLATKEFTSGAGADVILDIIGAKYLADNVEALAPNGRITVIGLQGGRKA
ELDLALLLNRRGSVSATSLRARPRADKSRIVAGVEREVWPLVEAGTVKPVVHTALPLAEA
AEAHRLIEASDHVGKILLLP
selected fasta
>putative oxidoreductase [putative quinone oxidoreductase]
ATGCAAGCGATCGTCATCGAGGACAAGCAGCTCGTGCTGCGCGAGGTCGAGGACCCCAGG
CCCGGACCGGGCGAGGTGGTCGTCGACGTGGCCGCGGCCGGTGTCAACCGGGCCGACGTC
TCCCAGCGGCAGGGCCTGTACCCGCCGCCGCCGGGCGCCGCGCCCTACCCGGGGCTGGAG
GTCTCGGGCGTGGTCAGCGCCCTCGGCATCGGGGTGAAGGGGCGCCGGGTCGGCGACGAG
GTCGCCTGCCTGCTGGCCGGCGGCGGCTACGCCGAGCGGGTCGCGGTACCCGCCGCGCAC
ACCCTGCCGGTGCCGGCCGGGGTGTCCCTGCGGGACGCGGCGGCCCTGCCCGAGGTCGCC
TGCACGGTCTGGTCCAACGTGGTCGACCGCGACGCCCTGCGGGAGGGCGAGACGCTGCTG
GTCCACGGCGGCGGCAGCGGCATCGGCACCTTCGCGATCCAACTGGGCAAGGCACTGGGC
GCGTCGGTAGTGGTGACCGCCCGCGCGGCCAAGCACGACCGGCTGCGGGCCCTCGGCGCG
GACCTCGCGGTCGACTACACCACCGAGGACTTCGTGCTGGCCACGAAGGAGTTCACCTCC
GGTGCCGGCGCCGACGTCATCCTCGACATCATCGGCGCGAAGTACCTCGCGGACAACGTC
GAGGCCCTCGCCCCGAACGGCCGGATCACCGTCATCGGCCTCCAGGGCGGCCGCAAGGCC
GAACTGGACCTCGCGCTGCTGCTCAACCGGCGCGGTTCGGTCTCGGCGACGTCGCTGCGC
GCCCGGCCGCGGGCCGACAAGTCGCGCATCGTCGCCGGAGTCGAGCGGGAGGTGTGGCCC
CTGGTCGAGGCGGGCACCGTCAAGCCGGTCGTGCACACCGCCCTGCCGCTGGCCGAGGCG
GCCGAGGCGCACCGCCTGATCGAGGCGAGCGACCACGTCGGCAAGATCCTCCTGCTGCCG
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [1-154]  5.50001754266469e-37 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [147-259]  1.4e-23 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [23-83]  1.1e-08 PF08240
PF08240   ADH_N
IPR014189 Quinone oxidoreductase PIG3 (Family)
 [1-318]  7.40000000000007e-126 TIGR02824
TIGR02824   Quinone_pig3
IPR016040 NAD(P)-binding domain (Domain)
 [145-253]  1.4e-27 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit