close all open/close all

CDS information : Rever_00220


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction50,747 / 51,664 / + [in whole cluster]
50,747 / 51,664 / + [in contig]
Location50747..51664 [in whole cluster]
50747..51664 [in contig]
TypeCDS
Length918 bp (305 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative esterase
Product (GenBank)putative thioesterase
Gene
Gene (GenBank)revN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
O52270
PmId
[9464382] A cold-adapted lipase of an Alaskan psychrotroph, Pseudomonas sp. strain B11-1: gene cloning and enzyme purification and characterization. (Appl Environ Microbiol. , 1998)
ACC
Q8NKS0
PmId
[12147492] Extremely stable and versatile carboxylesterase from a hyperthermophilic archaeon. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative esterase [putative thioesterase]
MPLDPAVKAVLDILDAAGDRQLHELPMPLARANYDQLAGLGGEPAAIGRTERTTADGVPV
RLYWPDSPGPHPILLFFHGGGWVLGSLDGYDGVARDLSAHADCLVVSVGYRLAPDHCFPA
AVEDALTVAKWAMRTGDAYGGDTQRLAVAGDSAGGNLSAVLVNELPGRFRAQALLYPVTD
QTRKHPSVRENGQGYLLTEDTLRWFSENYLGDQDPRHPWASPLFAADEVLAAAPPTLVVT
GEFDPLRDEGEAYADRLRALGVHVENRRYDGMIHAFFSMRGMVPAAGEALRQVTDFLQEA
WTQHT
selected fasta
>putative esterase [putative thioesterase]
ATGCCACTCGACCCCGCGGTCAAGGCCGTCCTCGACATCCTTGACGCCGCCGGCGACAGG
CAGCTGCACGAGCTGCCGATGCCCCTCGCGCGGGCGAACTATGACCAACTCGCCGGGCTC
GGCGGCGAACCGGCGGCGATCGGCCGCACCGAGCGCACCACCGCCGACGGGGTGCCGGTC
CGGCTGTACTGGCCGGACAGCCCGGGCCCGCACCCGATCCTGCTCTTCTTCCACGGCGGC
GGCTGGGTGCTCGGCAGCCTCGACGGGTACGACGGCGTGGCCCGCGACCTGAGCGCGCAC
GCCGACTGCCTGGTGGTCAGCGTCGGCTACCGCCTCGCCCCCGACCACTGCTTCCCCGCC
GCGGTCGAGGACGCCCTCACCGTCGCCAAGTGGGCGATGCGGACGGGCGACGCGTACGGC
GGCGACACCCAGCGGCTGGCGGTGGCCGGCGACTCGGCGGGCGGCAACCTCAGTGCCGTG
CTCGTCAACGAACTGCCCGGCCGGTTCCGGGCGCAGGCGCTGCTCTACCCCGTCACCGAC
CAGACTAGGAAGCACCCCTCGGTCCGCGAGAACGGGCAGGGCTACCTGCTCACCGAGGAC
ACCCTGCGCTGGTTCAGCGAGAACTACCTCGGCGACCAGGACCCGCGCCACCCGTGGGCG
TCGCCGCTGTTCGCCGCCGACGAGGTGCTCGCGGCCGCGCCCCCGACCCTCGTGGTCACC
GGCGAGTTCGACCCGCTGCGCGACGAGGGCGAGGCCTACGCCGACCGGCTGCGCGCGCTC
GGCGTCCACGTCGAGAACCGCCGCTACGACGGCATGATCCACGCCTTCTTCTCCATGCGC
GGGATGGTGCCGGCCGCCGGCGAGGCCCTGCGCCAGGTGACGGACTTCCTCCAGGAAGCC
TGGACGCAACACACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013094 Alpha/beta hydrolase fold-3 (Domain)
 [74-277]  1.5e-70 PF07859
PF07859   Abhydrolase_3
SignalP No significant hit
TMHMM No significant hit