close all open/close all

CDS information : Rever_00230


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction52,185 / 71,039 / + [in whole cluster]
52,185 / 71,039 / + [in contig]
Location52185..71039 [in whole cluster]
52185..71039 [in contig]
TypeCDS
Length18,855 bp (6,284 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GenerevC
Gene (GenBank)revA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionPKS/NRPS Module

0 methylmalonyl-CoA
1 malonyl-CoA
2 methylmalonyl-CoA
3 malonyl-CoA
KSQ8..381
AT546..886
ACP963..1033
KS1057..1430
AT1588..1894
dh1942..2095
KR2420..2596
ACP2695..2765
KS2788..3162
AT3337..3649
DH3697..3855
KR4131..4307
ACP4410..4480
KS4503..4872
AT5035..5341
DH5389..5552
KR5853..6029
ACP6130..6200

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MDHEFSDSDVAVIGMACRLPQAPDPAGFWRLLRTGTSAVGEVPADRWPDRPGNDGHDDAL
RALVRRGAFIDAPDAFDAAFFGVSPRESAEMDPQQRLALELGWEALEDAGVVPETLRGLP
VGVYVGAMASDHAHLTSLRSPQALNHHTMAGTHRAVIANRISYFAGLRGPSMTVDTGQSS
SLVAVHMACEALRTGEARLALAGGVNLNLTEQTALLEARLGALSPDGRCFTFDERANGYV
RGEGGGFVVLKPLRDALADGDDVYCVIRGSAVNNDGAGDSLLVPTVTGQREVLTRAYDRA
GIAPGAVQYVELHGTGTKVGDPVEAEALGHALGTDPDREHPLLVGSVKTNVGHLEGAAGI
TGLLKVALMLKHRRIPASLNFRRLNPDIRADEWNLRVAAEPGPWPEPAGTLHAGVSSFGM
GGTNCHVVLSSPVRAEAPPAPETAPGPAADAHPGPAELALVVSAKSPAALRAQAELLLDR
MAADPAPDPADVAWSLVGSRSAFPHRAVVVGREAQELTTGLAALAAGEPAAGLVQGHARP
DHRVAFVFPGQGAQWTGMATGLMADSPVFRAAIEECAQALRPYVDWSLTDVLDDRAALER
VDVVQPALWAVMVSLARLWRWMGVEPAAVVGHSQGEIAAACVAGGLSLDDGARVVALRSQ
AIAQTLTGRGGMAVVALPAPEAADLIAPWDGRLSIATVNGPGSVVVSGESAAVGELAARC
ADTGIRVRPVSVDYASHSAAVEEIEDRLLADLAPLRPRAGTVPMYSSVTGAPVDTTELDA
RYWYRNLRQTVRFETATRALAADGISVLVEVSPHPVLTVPVQDTLDSLGEADGQDGAAGP
DGRTGPGGPDAAAGRTAVVTGSLRRDQGGLDRFLTSVAQVHVHGVPVAWAALFEGSRPRR
IKLPTYAFQRDRHSVIGLGQEPVRLLEADAGATPGLAPATGDQDDAFLGKLAPMSAKERD
AHLLSVVRDHAAALLGHRGGADVDPTVPFRSAGFDSMTAVDLRNRLQSATGLPIPSSMVF
DYPTPARLAAFLAGRLGGTRSADDTALPLPAAPVADDPLVIVGMSCRFPGGVAGPEQMWD
LVIGERDAITGFPTDRDWDLEHLYGPDTAGRLAGGFVEGALDFDAGFFAMSPREALATDP
QQRLLLEGSWEALEHAGIDPVSLAGSATGVFVGSYQSGYAEVVSAALVDADADAQLLTGG
AQSVLSGRVAYALGLVGPAVTVDTACSSSLVALHLAGQALRGGECSLALVAGVTVNALPH
TFVGFSQQGGLSADGRCKAFAEAADGTGFSEGMGVLVVERLSDAERNGHRVLAVVRSSAV
NQDGASNGLTAPNGPSQQRVIRQALAAAGLSSGDVDVVEGHGTGTTLGDPIEAQAVLATY
GQDRSEERPLLLGSLKSNIGHTQAAAGVAGVIKMVLAMRHGVVPRTLHVDEPSSHVDWGQ
GRVRLLTESVAWPESGRPRRAGVSSFGISGTNAHVILEAAPAVESEVEVEVAGGAGAEHA
SETVWVVSGRSEGALRAQAERLLSVAEGLDPVDVGGALLSRSVFEHRAVVVGSGREELTA
GLRALAAGEAAGNAVEGVARSGRRVAVLFAGQGAQRLGMGRRLHEESSVFAAAFDEVVAE
LDRHLDVPLREVVWGEDAEALNSTGWAQPALFAVEVALFRLLESFGVTPDYLLGHSIGEV
AAAYVAGVFDLVDACRLVGARARLMQALPVGGAMVAVAAPEEEVLPHLSDGVSVAAVNAP
GSVVVSGEESAVLAVGEHFKALGVKTTRLRVSHAFHSALMEPMVDDFLAAIADVSFSEPR
IAVVSNLTGEPADMTSPKYWAQQVRSGVRFADGVAWLTAQGVDVFVDAGPDGVVAGLAQA
NASDAVAVALMRKDRGDVRTVFHAVGQLFVEGVPVGWETLFAGAGPRRVDLPTYAFQRRR
YWPQASLAGGDVIAAGLASAEHPLLSAVVSVPGSGAVVLTSRLSARTQPWLAGHAVQGTV
VFPGAGLVELAIRGADAVGAGGLRELEVEAPLVVPETASVQVQVVVADGRLEIYSRATDD
DPWTRHATAVLGDALAAGAADWPWPPAADSRVDLPDLSEATDGDGLADGPALQGLRQVWQ
ADGEVFAEVAVAENEADRARKFGVHPDLLEAALRASAFAEPDPVPAGRVWTGFADVTLHA
EGATAARARVVRTGPDRVSVELFDGNGEPVLSIGSVTLGAAPASGPLAASRNGTALALDW
PALPAAETGADSAEGAGVPDGVDAPGGPAFAFVQAPTADPSWLPEPAYPHLDGVLADGNP
PRYVVLAVSGGAPDDMVRAVHATTRWALEQLQSWLAEERFADTTLVALTRGAVSAGHDEP
VPDLGAAAVWGLLRTAQREHPGRVVLVDTEPGIDLDVRRLALALRGGEPQLALRGEEIRA
ARLVRVTAQDAPEARPEPEGTVLVTGGTGGLGREVARHLVAVHGVRSLLLLSRRGLAAEG
ARELVEELGALGAEVVVGACDVADRAALAEVLAGVRLTGVVHTAGVVDDGLVSSLTAERL
DRVLVPKVDAAWHLHELTAGADLAFFAVFSSLSGILGNPGQANYAAGNVFLDALMQARRH
AGLPGVSMAWGAWTQDVGLTAALTEADMRRLARSGMRPLSVPEGLALFDRALASDRALLG
LASLDLAALRARDDLPVFRSLAGGRARRRAGEQQLAGGLAERMARLTEPEREDFLLTLIR
DHAAAVLGHASGQHLNVTTAFREMGFDSLMGVELRNRVKRGTGLPVADSMVYDYPTPLRL
AQYLASLMGGVEVRAGGATPARALADDDRLAIVGMACRFPGGVTNPDELWKLIAEGGDAI
AGFPDDRGWDVEQLYDAEGTRSGSSVTRSGGFVEADGFDSAFFGISPREALAMDPQQRLL
LESSWEALEDAGIDPQSLAGSSTAVVFGISQSHYGELVRPLEETQGHLLTGGAFSVASGR
VAYTLGLEGPAVTVDTACSSSLVALHLAGQALRAGECSMALAGGVTVMATPGTFVEFSRQ
GGLSADGRCRAFADGADGTGWSEGVGVLVVERLSDAERNGHRVLAVVRASAVNQDGASNG
LTAPNGPSQQRVIRQALAAAGLNSGDVDAVEAHGTGTRLGDPIEAQALLSTYGQDRPEER
PLWLGSLKSNIGHTQAAAGVAGVIKMVLAMRHGVLPQTLHVDEPSSRVDWDQGRVRLLTE
SVAWPESGRPRRAGVSSFGMSGTNAHVILEAPATPEPPAGAAVPAGIEPGTAADADPQQG
AVSPAVGWVLSARSEDGLRGQAGRLLAAVESSGSAGSVEPVDVGAALLSRSLFDHRAVVV
GADREQLVSGVRALAAGEPAGNLVGGAAGGGQERRVVFVFPGQGAQWVGMAEGLLNSSSV
FRESMELCGEALRPFVEWDLLGVLGEGDEVVLGRVDVVQPVLWAVMVSLAAVWRSWGVVP
AAVVGHSQGEIAAACVAGGLSLGDGARVVALRSRAIAGALAGRGGMVAVSLPVEGVRGLL
SGGLSVAVVNSPGGVVVAGPVEELDALLVVCEERGVRARRVPVDYASHSVFVELIEDRVL
ADLAGLAPVSGSVPMYSSVSGERVDTAGLDGGYWYRNLRQTVEFERATRALAADGFSVFV
EVSPHPVLTVAVQDTLGEGVVAAGTLRRHEGGLDRFLLSAAELFVHGVPVTWNGLFADRK
PRPVSLPTYAFQHQRYWPQPSLVAGDVAAAGLVSAEHPLLGAVVSVPGSDTVVLTSRLSL
RAQPWLGDHAVHGTVIFPGTGFVELAIRGADAAGAGRLRELIVEAPLAVPAGGSVQVQVV
ADAEDHTVAVYARADEDEPWTRHAIGAVDDETAGVDTADLAGEWPPAGSTPVDLEDFYQR
SADSGFGYGPVFQGLTRAWRLDGRIYAEAALPDDQAAAATAFGIHPALLDAALHPNTFAD
LEPTELGRLPFTFDDVTLHATGARAVRIRMARTGPDSVTAVLADETGAPVLSIGSLVMRP
VPEQVLGGARAPETMLALVWNEVPDASGAAAGAEPGAAPAQDGDVLLEVPAAADGSPESV
HAAVAWTLGQLQGLSGGRLVVLTRGAVAALPGETVTDLAAAAVWGLVRSAQSEDPGRIVL
VDADEGTRATRDLLARVAGTGEPQLAVREGALLAPQLTRTTETGEPVALDGTVLITGGTG
GLGSAVARHLVAAYGVRSLLLLSRRGGTAPGAAELVEELTAQGAEVTVVACDAADRSALA
EVLAGVPLAGVVHTAGILDDGVISTLTPEQVHRVLTPKVDAAWHLHDLTRDRDLAMFVVF
SSLAGLIGSPGQGNYAAGNVYLDSLVQQRRAAGLAGISMAWGPWDQSLGLTGALSGTDMH
RLGRLGMLPISEEQGMALFDQALSAGLPLLGLTELKASALRATTEVPALFRSLAGGPARR
TRARAGAAAPAAGLAGRLAGLTPEQRQSHLLGLVREHAAAVLGHGSGSRIAAEQPFREVG
FDSLTAVELRNRLQAVTELSLPSTLVFDYPNAVRLAGYVGERLGGVTAAPVDALPVLRSV
DDDPLVIVGMSCRFPGGASDPDRLWDLLEQGRDGMGAFPGDRGWDTGLLTELAHAGGFVE
GALDFDAGFFAMSPREALATDPQQRLLLEGSWEALEHAGIDPVSLAGSATGVFVGSYQSG
YAEVVSAALVDADADAQLLTGGAQSVLSGRVAYALGLVGPAVTVDTACSSSLVALHLAGQ
ALRGGECSLALVAGVTVNALPHTFVGFSQQGGLSADGRCKAFAEAADGTGFSEGMGVLVV
ERLSDAERNGHRVLAVVRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAAGLSSGDVDVV
EGHGTGTTLGDPIEAQAVLATYGQDRSEERPLLLGSLKSNIGHTQAAAGVAGVIKMVLAM
RHGVVPRTLHVDEPSSHVDWGQGRVRLLTESVAWPESGRPRRAGVSSFGISGTNAHVILE
AAPGVEAEVEVVEGDGAESGSESGSGSVWVVSGRSEGALRAQAERLLSAVSEAESWGSAA
VGAALLSRSVFDHRAVVVGADRAELVAGLGALASGEPGALVAQGVARSGRRVAVLFAGQG
AQRLGMGRRLHEESPVFAAAFDEVVAELDRHLEAPLREVLWGEDAEALNSTGWAQPALFA
VEVALFRLLESFGVTPDYLLGHSIGEVAAAHVAGVFDLVDACRLVGARARLMQALPVGGA
MVAVAAPEEEVLPHLSDGVSVAAVNAPGSVVVSGEEGAVLEVGEHFKALGVKTTRLRVSH
AFHSALMEPMVDDFLAAIADVSFSEPRIAVVSNLTGEPADMTSPKYWAQQVRSGVRFADG
VAWLTAQGVDVFVDAGPDGVVAGLAQANASDAVAVALMRKDRGDVRTVFHAVGQLFVEGV
PVAWETLFAGAGSRRVDLPTYAFQRRRYWPQASLAGGDVAAAGLVSAEHPLLGAVVSVPE
SGTVVLTSRLSLRAQPWLGDHAVHGTVVFPGAGFVELAIRGADAVGAGGLRELVVEAPLV
VPAVGSVQVQVVVGDGGSLTVYARAADEEPWTRHATAVLGDALPADADADAVGAGAGGWQ
WPPADASSVDVSDFYPSLADEGFAYGPAFQWLRQVWVGPEEVFAEVAVADEAADQARKFG
VHPALLDAALQASTFAGLDPAPAGRMPFSFADVTLHAGGATATRVHMVRTGPDSVSVELA
DGNGDPVLTIGTLVLQPVTATGPVGGAQAGAVLAVDWSSVVALDEAAGPGAPLRVVGAPE
DLVVEDLVPGEVVVLEAVGTAGEVVGSAHGLAGWVLAQVQGWLGDERCAEGRLVVVTRGA
VSAVPGEVLADVAASAVWGLVRSAQAENPGRITLLDLGAGEGVGSVDRAVVVGAVNSGEP
QLVVRDGVVRAARLVRVAAAADGDAGSVGFGAGTVLVTGGTGGLGREVARHLVAVHGVRS
LLLLSRRGLAAEGARELVEELGALGAEVVVGACDVADRAALAEVLAGVRLTGVVHTAGVV
DDGLVSSLTVERLDRVLAPKVDAAWYLHELTAGMDLSAFVVFSSLAGVVGSPGQGNYAAG
NVFLDALMQYRRLEGLPAVSMAWGPWAQGAGLTGELSDVDMRRIAASGTPPFTVEQGLAV
FDAALGSPEAAVALTRLDLAALRTRDELPPLWGLLAGKRGRPVASDRRQESGTLADRLSA
LALPERTDQLLVLVRDHVAAVLGFASREQIDTTQAFRELGFDSLSALELRNRLQTATGLT
VSSTLVFDYPNPQRLAAHLAEQFGTAGGAETGAAALLAQLDALSSTLARADVVDEDREAI
AHRLRSMLDTWRSPEEENADEDWETPDEVFRFIDDELGISESEV
selected fasta
>polyketide synthase [polyketide synthase]
ATGGACCACGAATTCTCCGACTCGGACGTCGCCGTCATCGGAATGGCGTGCCGCCTCCCG
CAGGCACCGGACCCCGCCGGCTTCTGGCGGCTGCTGCGCACCGGCACCAGCGCCGTCGGC
GAGGTCCCCGCGGACCGCTGGCCCGACCGGCCCGGCAACGACGGCCACGACGACGCCCTG
CGGGCCCTCGTCCGCCGCGGCGCCTTCATCGACGCGCCGGACGCCTTCGACGCGGCCTTC
TTCGGCGTCTCGCCGCGCGAGAGCGCCGAGATGGACCCCCAGCAGCGCCTGGCCCTCGAA
CTCGGCTGGGAGGCACTGGAGGACGCCGGCGTCGTCCCCGAGACGCTGCGCGGCCTGCCG
GTGGGCGTCTACGTCGGAGCGATGGCCAGCGACCACGCCCACCTGACCTCCCTGCGCAGC
CCCCAGGCGCTCAACCACCACACCATGGCCGGCACGCACCGGGCCGTCATCGCCAACCGC
ATCTCGTACTTCGCGGGACTGCGCGGGCCGAGCATGACCGTCGACACCGGCCAGTCCTCC
TCCCTCGTCGCGGTCCACATGGCCTGCGAGGCGCTGCGCACCGGAGAGGCGCGGCTCGCC
CTCGCCGGCGGCGTCAACCTCAACCTCACCGAGCAGACGGCCCTCCTGGAGGCCCGGCTC
GGCGCGCTGTCCCCCGACGGAAGGTGCTTCACCTTCGACGAGCGGGCCAACGGCTACGTC
CGCGGCGAGGGCGGCGGCTTCGTCGTCCTCAAGCCCCTCCGGGACGCGCTGGCCGACGGC
GACGACGTCTACTGCGTCATCCGCGGCAGCGCCGTCAACAACGACGGCGCCGGCGACAGC
CTGCTGGTGCCGACCGTGACCGGCCAGCGCGAGGTGCTCACCCGCGCCTACGACCGGGCC
GGCATCGCCCCCGGCGCGGTGCAGTACGTCGAACTGCACGGAACCGGAACCAAGGTCGGC
GACCCGGTCGAGGCCGAGGCCCTCGGCCATGCCCTCGGCACCGACCCCGACCGCGAACAC
CCCCTGCTCGTCGGCTCCGTGAAGACCAACGTCGGCCACCTGGAAGGCGCCGCCGGCATC
ACCGGCCTGCTCAAGGTCGCCCTCATGCTCAAGCACCGCCGGATCCCGGCCAGCCTGAAC
TTCCGACGGCTCAACCCCGACATCCGCGCCGACGAGTGGAACCTGCGGGTCGCCGCCGAA
CCCGGTCCGTGGCCGGAGCCCGCGGGCACGCTGCACGCCGGCGTGTCCTCGTTCGGCATG
GGCGGCACCAACTGCCACGTCGTGCTCAGCTCCCCGGTGCGGGCCGAGGCCCCGCCCGCC
CCCGAGACCGCCCCCGGCCCCGCGGCCGACGCGCACCCCGGCCCCGCCGAACTCGCCCTC
GTCGTGTCCGCCAAGTCCCCGGCGGCCCTGCGCGCCCAGGCCGAACTGCTGCTGGACCGG
ATGGCCGCCGACCCCGCGCCGGACCCCGCCGATGTCGCCTGGTCGCTGGTCGGCTCGCGC
TCCGCCTTCCCCCACCGCGCCGTCGTCGTCGGCCGCGAAGCGCAGGAGCTGACCACCGGA
CTCGCCGCCCTGGCCGCGGGCGAGCCCGCCGCCGGACTCGTCCAGGGCCACGCGCGGCCC
GACCACCGGGTGGCGTTCGTCTTCCCCGGCCAGGGCGCCCAGTGGACCGGCATGGCGACC
GGGCTGATGGCGGACTCACCGGTCTTCCGCGCGGCGATCGAGGAGTGCGCCCAGGCGCTG
CGCCCCTACGTCGACTGGTCGCTCACCGACGTCCTCGACGACCGGGCCGCCCTCGAACGC
GTCGACGTGGTCCAACCCGCGCTGTGGGCCGTCATGGTCTCCCTCGCCCGACTGTGGCGC
TGGATGGGCGTCGAACCCGCCGCCGTCGTGGGGCACTCCCAGGGCGAGATCGCCGCCGCC
TGCGTCGCCGGCGGCCTGTCCCTGGACGACGGCGCCCGCGTGGTGGCCCTGCGCAGCCAG
GCCATCGCCCAGACCCTCACCGGCCGCGGCGGCATGGCCGTCGTGGCACTGCCCGCCCCC
GAGGCCGCGGACCTCATCGCCCCCTGGGACGGCCGGCTGTCCATCGCCACGGTCAACGGC
CCCGGCTCGGTCGTCGTGTCCGGCGAGTCCGCGGCCGTCGGGGAACTGGCGGCGCGGTGC
GCGGACACCGGGATCCGGGTCCGCCCGGTCTCCGTGGACTACGCCTCGCACTCCGCGGCC
GTCGAGGAGATCGAGGACCGGCTGCTCGCCGACCTGGCACCGCTGCGCCCGCGCGCGGGC
ACGGTGCCGATGTACTCCTCCGTGACCGGCGCCCCCGTGGACACCACGGAACTCGACGCC
CGCTACTGGTACCGCAACCTCCGGCAGACGGTGCGGTTCGAGACCGCCACCCGCGCGCTC
GCCGCCGACGGGATATCGGTCCTGGTCGAGGTCAGCCCGCACCCGGTGCTCACCGTGCCG
GTCCAGGACACCCTGGACTCCCTCGGCGAGGCGGACGGCCAGGACGGCGCGGCCGGTCCC
GACGGCCGCACCGGACCCGGCGGCCCCGACGCGGCCGCGGGCCGCACGGCCGTCGTCACC
GGCAGCCTGCGCCGCGACCAGGGCGGCCTGGACCGCTTCCTCACCTCGGTCGCCCAGGTC
CACGTGCACGGCGTGCCCGTCGCGTGGGCCGCCCTCTTCGAGGGCTCGCGGCCGCGGCGG
ATCAAGCTGCCCACGTACGCCTTCCAGCGCGACCGGCACTCCGTCATCGGCCTCGGCCAG
GAGCCCGTCCGGCTCCTGGAGGCCGATGCCGGCGCCACGCCCGGGCTCGCGCCCGCCACC
GGCGACCAGGACGACGCGTTCCTCGGCAAGCTGGCCCCGATGTCCGCCAAGGAGCGCGAC
GCCCACCTGCTCTCGGTGGTCCGCGACCACGCCGCCGCCCTGCTCGGCCACCGCGGCGGT
GCCGACGTGGACCCCACCGTGCCCTTCCGGTCGGCGGGGTTCGACTCGATGACCGCGGTC
GACCTGCGCAACCGGTTGCAGAGCGCCACCGGCCTGCCCATCCCGAGCAGCATGGTGTTC
GACTACCCCACGCCCGCCCGCCTCGCGGCCTTCCTGGCCGGCCGGCTCGGCGGCACCCGG
TCCGCCGACGACACCGCGCTCCCGCTGCCCGCCGCCCCGGTCGCCGACGATCCGCTGGTC
ATCGTGGGCATGTCCTGCCGCTTCCCCGGCGGCGTCGCCGGCCCCGAGCAGATGTGGGAC
CTCGTCATCGGTGAGCGCGACGCGATCACCGGCTTCCCGACCGACCGCGACTGGGACCTG
GAACACCTCTACGGCCCCGACACCGCGGGCCGCCTGGCCGGCGGGTTCGTGGAGGGGGCG
TTGGACTTCGATGCGGGGTTCTTCGCGATGTCGCCGCGTGAGGCGTTGGCGACGGATCCT
CAGCAGCGGTTGTTGTTGGAGGGGTCGTGGGAGGCGTTGGAGCATGCGGGGATTGATCCG
GTGTCGTTGGCGGGTTCGGCGACGGGGGTGTTCGTCGGCAGTTACCAGTCCGGTTATGCG
GAGGTGGTGTCGGCGGCGTTGGTGGATGCGGATGCGGATGCGCAGTTGTTGACGGGTGGT
GCGCAGAGTGTGTTGTCGGGGCGGGTGGCGTATGCGTTGGGGTTGGTGGGTCCGGCGGTG
ACGGTGGACACGGCGTGTTCGTCGTCTTTGGTGGCGTTGCATTTGGCGGGTCAGGCGTTG
CGGGGTGGGGAGTGCTCGCTGGCGTTGGTGGCGGGTGTGACGGTGAATGCGTTGCCGCAC
ACGTTTGTGGGGTTCTCGCAGCAGGGTGGGTTGTCGGCTGATGGTCGGTGCAAGGCGTTC
GCGGAGGCGGCGGACGGGACGGGTTTCAGTGAGGGGATGGGGGTGTTGGTTGTCGAGCGT
TTGTCTGATGCGGAGCGGAACGGGCATCGGGTGTTGGCGGTGGTGCGGTCGAGTGCGGTG
AACCAGGACGGTGCGTCGAACGGGTTGACGGCGCCGAACGGTCCGTCGCAGCAGCGGGTG
ATCCGGCAGGCGCTGGCGGCTGCGGGGTTGTCGTCGGGGGATGTGGATGTGGTGGAGGGG
CATGGCACGGGCACGACGTTGGGCGACCCGATCGAGGCTCAGGCGGTGTTGGCGACCTAC
GGCCAGGATCGGTCGGAGGAGCGGCCGTTGTTGTTGGGGTCGTTGAAGTCGAACATCGGT
CATACGCAGGCGGCTGCGGGTGTGGCGGGTGTGATCAAGATGGTGTTGGCGATGCGGCAT
GGGGTGGTGCCGCGGACGTTGCATGTGGATGAGCCGTCGTCGCATGTGGACTGGGGCCAG
GGTCGGGTGCGGTTGCTGACGGAGTCGGTGGCATGGCCGGAGAGCGGTCGTCCGCGGCGG
GCGGGTGTGTCGTCGTTCGGGATCTCGGGGACGAACGCGCACGTGATCTTGGAGGCGGCT
CCCGCGGTGGAGTCCGAGGTCGAGGTGGAGGTCGCGGGAGGGGCTGGGGCCGAGCACGCC
TCCGAGACGGTGTGGGTGGTGTCGGGTCGTTCGGAGGGGGCGTTGCGGGCGCAGGCGGAG
CGGCTGTTGTCGGTGGCCGAGGGGCTGGATCCGGTGGATGTGGGTGGGGCGTTGTTGTCG
CGGTCGGTGTTCGAGCACCGTGCGGTGGTGGTGGGCAGTGGGCGTGAGGAACTGACGGCG
GGGTTGCGGGCGTTGGCGGCCGGTGAGGCGGCGGGGAACGCGGTGGAGGGTGTGGCGCGG
AGTGGTCGTCGGGTGGCGGTGTTGTTCGCGGGTCAGGGTGCGCAGCGGCTGGGGATGGGC
CGCCGGCTGCACGAGGAGTCGTCGGTGTTCGCGGCGGCTTTCGACGAGGTGGTGGCGGAG
TTGGACCGGCACCTCGACGTTCCGTTGCGGGAGGTGGTGTGGGGTGAGGACGCGGAGGCG
TTGAACTCGACGGGTTGGGCGCAGCCGGCGTTGTTCGCCGTCGAGGTGGCGCTGTTCCGG
CTGCTCGAATCCTTTGGCGTCACACCGGATTACCTGCTGGGGCACTCCATTGGTGAGGTG
GCTGCGGCTTACGTCGCCGGGGTGTTTGATCTGGTGGATGCGTGTCGGTTGGTGGGGGCG
CGGGCGCGTTTGATGCAGGCGCTTCCGGTGGGTGGGGCGATGGTGGCGGTTGCCGCGCCG
GAGGAGGAGGTGCTGCCGCATCTGTCGGACGGGGTGTCGGTGGCGGCGGTGAACGCGCCG
GGTTCGGTGGTGGTCTCCGGTGAGGAGTCCGCTGTGCTCGCGGTCGGTGAGCATTTCAAG
GCGTTGGGGGTGAAGACGACTCGGCTGCGCGTCTCGCACGCCTTCCATTCGGCGTTGATG
GAGCCGATGGTGGACGACTTCCTGGCGGCGATCGCGGATGTGTCGTTCTCGGAGCCGCGG
ATTGCGGTGGTGTCGAATCTGACGGGTGAGCCGGCGGATATGACGTCGCCGAAGTACTGG
GCGCAGCAGGTGCGTTCGGGGGTGCGGTTCGCGGACGGTGTGGCGTGGTTGACGGCGCAG
GGTGTGGACGTGTTCGTGGATGCGGGTCCTGATGGTGTGGTGGCGGGTCTGGCGCAGGCC
AACGCGTCGGATGCGGTGGCGGTGGCGTTGATGCGCAAGGATCGTGGTGATGTGCGGACG
GTGTTCCACGCGGTGGGGCAGTTGTTCGTGGAGGGTGTGCCGGTCGGGTGGGAGACGTTG
TTCGCCGGTGCGGGGCCCCGTCGGGTGGATCTGCCGACGTATGCGTTCCAGCGCCGCCGT
TACTGGCCGCAGGCGTCCCTCGCGGGCGGCGACGTGATCGCCGCCGGTCTGGCGTCCGCC
GAGCACCCGTTGCTGAGCGCGGTGGTGTCGGTGCCCGGTTCGGGTGCCGTCGTGCTGACC
TCGCGGCTCTCGGCACGTACACAGCCGTGGCTGGCCGGCCACGCCGTCCAGGGGACGGTG
GTCTTCCCCGGTGCCGGTCTCGTGGAGCTGGCGATCCGCGGCGCGGACGCCGTGGGCGCG
GGCGGGCTGCGGGAGTTGGAGGTGGAAGCCCCGCTGGTCGTTCCGGAGACCGCGAGCGTC
CAGGTCCAGGTCGTCGTGGCGGACGGCCGGCTGGAGATCTACTCGCGCGCCACCGACGAC
GACCCGTGGACCCGGCACGCGACCGCCGTGCTCGGTGACGCCCTCGCCGCCGGGGCGGCC
GACTGGCCGTGGCCGCCCGCCGCGGACTCGCGCGTGGACCTCCCCGACCTCTCCGAGGCG
ACCGACGGTGACGGTCTCGCGGACGGCCCGGCCCTCCAGGGGCTGCGGCAGGTCTGGCAG
GCCGACGGCGAGGTCTTCGCCGAGGTGGCCGTGGCAGAGAACGAGGCCGACCGGGCGCGC
AAGTTCGGCGTTCACCCGGACCTGCTGGAGGCGGCCCTCCGGGCGAGCGCCTTCGCGGAG
CCGGACCCCGTCCCGGCCGGGCGGGTGTGGACCGGCTTCGCCGACGTGACCCTGCACGCC
GAGGGCGCGACGGCGGCACGCGCCCGGGTGGTCCGTACGGGCCCGGACCGCGTGAGCGTG
GAACTCTTCGACGGCAACGGCGAGCCGGTGCTGTCCATCGGCTCCGTGACGCTGGGCGCG
GCTCCCGCCTCCGGACCCTTGGCCGCCTCCCGGAACGGGACGGCGCTGGCCCTCGACTGG
CCGGCGCTGCCCGCGGCGGAGACCGGCGCGGACTCCGCCGAGGGCGCGGGAGTTCCGGAC
GGAGTGGACGCTCCGGGCGGCCCGGCGTTCGCGTTCGTCCAGGCGCCCACGGCCGACCCT
TCGTGGCTGCCGGAACCGGCGTACCCGCACCTCGACGGCGTCCTCGCCGACGGCAACCCG
CCGCGGTACGTGGTGCTCGCCGTGTCGGGCGGGGCGCCCGACGACATGGTGCGGGCCGTG
CACGCCACGACGCGGTGGGCCCTGGAGCAGCTTCAGTCCTGGCTGGCCGAGGAGCGCTTC
GCCGACACCACCCTGGTCGCGCTCACCCGCGGCGCGGTCTCCGCGGGCCACGACGAGCCC
GTGCCGGACCTCGGCGCGGCCGCGGTGTGGGGGCTGCTGCGCACCGCGCAGAGGGAGCAC
CCGGGCCGGGTCGTCCTCGTGGACACGGAGCCCGGCATCGACCTCGACGTCCGGCGGCTG
GCGCTGGCGCTGCGCGGCGGCGAGCCGCAACTCGCCCTGCGCGGCGAGGAGATCCGCGCG
GCGCGGCTGGTCCGCGTCACCGCGCAGGACGCACCCGAGGCGCGCCCGGAGCCCGAGGGC
ACGGTGCTGGTCACGGGCGGTACGGGTGGTCTGGGCCGTGAGGTGGCGCGTCACCTGGTG
GCGGTGCACGGGGTGCGGAGTCTGCTGCTGCTGAGTCGTCGGGGTCTGGCGGCCGAGGGT
GCGCGGGAGTTGGTCGAGGAGTTGGGCGCGCTGGGCGCGGAGGTCGTGGTCGGGGCGTGT
GACGTCGCGGATCGTGCGGCGCTGGCGGAGGTGCTCGCGGGTGTGCGGCTGACGGGTGTG
GTGCACACGGCCGGTGTGGTGGACGACGGTCTGGTGTCGTCGTTGACCGCTGAACGCCTG
GACCGGGTGCTCGTGCCCAAGGTGGACGCGGCCTGGCACCTGCACGAGCTGACCGCCGGG
GCGGACCTGGCGTTCTTCGCCGTGTTCTCCTCGCTGTCCGGCATCCTCGGCAACCCCGGT
CAGGCCAACTACGCGGCCGGCAACGTCTTCCTCGACGCGCTGATGCAGGCCCGGCGCCAC
GCCGGTCTGCCCGGCGTCTCGATGGCCTGGGGCGCCTGGACGCAGGACGTGGGCCTGACC
GCCGCGCTCACCGAGGCCGACATGCGCCGGCTGGCCCGCTCGGGCATGCGGCCGCTGTCG
GTGCCGGAGGGCCTGGCCCTCTTCGACCGCGCTCTCGCGTCCGACCGGGCACTCCTCGGA
CTCGCCAGCCTGGACCTCGCCGCCCTCCGGGCCCGCGACGACCTGCCCGTCTTCCGTTCG
CTGGCGGGCGGCCGGGCCCGGCGCCGGGCCGGGGAGCAGCAGCTCGCCGGCGGCCTGGCC
GAGCGGATGGCCCGGCTGACCGAGCCGGAACGCGAGGACTTCCTCCTCACCCTCATCCGC
GACCACGCGGCGGCCGTCCTCGGCCACGCGTCGGGCCAGCACCTGAACGTCACCACGGCG
TTCCGGGAGATGGGCTTCGACTCGCTGATGGGCGTCGAACTGCGCAACCGCGTCAAGCGC
GGCACCGGCCTGCCGGTGGCGGACTCGATGGTCTACGACTACCCGACGCCGCTGCGGCTC
GCCCAGTACCTGGCGAGCCTGATGGGCGGCGTCGAGGTCCGGGCGGGCGGTGCCACGCCG
GCCCGCGCGCTCGCCGACGACGACCGACTGGCGATCGTGGGCATGGCCTGCCGCTTCCCC
GGCGGGGTCACCAACCCCGACGAGCTGTGGAAGCTCATCGCCGAGGGCGGCGACGCCATC
GCCGGGTTCCCCGACGACCGCGGCTGGGACGTCGAGCAGCTCTACGACGCGGAGGGCACC
CGGAGCGGAAGCTCCGTCACCCGCAGCGGCGGGTTCGTCGAGGCCGACGGGTTCGACAGC
GCCTTCTTCGGCATCTCGCCCCGCGAGGCCCTGGCGATGGACCCCCAGCAGCGGCTGCTG
CTGGAGAGCTCGTGGGAGGCGCTGGAGGACGCGGGGATCGACCCGCAGTCCCTGGCCGGC
AGCTCCACCGCGGTCGTGTTCGGCATCAGCCAGTCGCACTACGGCGAGCTGGTCAGGCCG
CTGGAGGAGACCCAGGGCCACCTGCTGACCGGCGGCGCCTTCAGCGTCGCGTCCGGCCGG
GTGGCGTACACGCTGGGTCTCGAAGGCCCCGCGGTGACGGTGGACACGGCCTGCTCGTCG
TCCCTGGTGGCACTGCACCTGGCCGGGCAGGCACTGCGGGCCGGCGAGTGCTCGATGGCG
CTGGCCGGCGGTGTGACGGTGATGGCGACGCCGGGCACCTTCGTGGAGTTCAGCCGGCAG
GGCGGTCTGTCGGCCGACGGCCGGTGCAGGGCGTTCGCGGACGGTGCGGACGGCACCGGC
TGGTCCGAGGGCGTCGGTGTGCTGGTGGTGGAGCGGTTGTCGGACGCGGAGCGCAACGGG
CACCGGGTGCTGGCGGTCGTACGTGCCAGCGCGGTGAACCAGGACGGCGCGTCGAACGGC
TTGACGGCGCCGAACGGTCCGTCCCAACAGCGGGTGATCCGGCAGGCGTTGGCGGCGGCC
GGGCTCAACTCCGGTGACGTGGACGCCGTGGAGGCGCACGGCACGGGCACCCGGCTCGGC
GACCCCATCGAGGCGCAGGCGCTGCTGTCCACGTACGGCCAGGACCGGCCGGAGGAACGG
CCCTTGTGGCTGGGGTCGTTGAAGTCGAACATCGGTCATACGCAGGCGGCGGCGGGTGTC
GCGGGCGTGATCAAGATGGTGCTGGCGATGCGGCACGGGGTGCTGCCGCAGACGTTGCAC
GTGGACGAGCCGAGTTCGCGCGTGGACTGGGACCAGGGTCGGGTGCGGTTGCTGACGGAG
TCGGTGGCCTGGCCGGAGAGCGGTCGCCCGCGGCGGGCGGGCGTGTCGTCGTTCGGGATG
TCGGGGACGAACGCGCACGTGATCCTGGAGGCCCCGGCGACCCCGGAGCCCCCGGCGGGC
GCGGCGGTCCCGGCCGGGATCGAGCCCGGCACCGCGGCGGACGCCGATCCGCAACAGGGC
GCCGTTTCGCCGGCCGTGGGATGGGTGCTCTCCGCCCGCTCCGAGGACGGGCTACGGGGT
CAGGCGGGTCGTCTGCTGGCGGCTGTGGAGTCGTCCGGGTCGGCGGGTTCGGTGGAGCCG
GTGGATGTGGGTGCGGCGTTGTTGTCGCGTTCGCTGTTCGACCACCGGGCGGTGGTGGTG
GGTGCGGATCGTGAGCAACTGGTGTCGGGTGTGCGGGCGTTGGCGGCGGGTGAGCCGGCC
GGGAACCTGGTGGGCGGCGCTGCCGGCGGTGGTCAGGAGCGTCGGGTGGTGTTCGTCTTC
CCGGGGCAGGGTGCGCAGTGGGTGGGTATGGCGGAGGGTCTGCTGAATTCCTCGTCGGTG
TTCCGGGAGTCGATGGAGTTGTGTGGGGAGGCGTTGAGGCCTTTTGTGGAGTGGGATTTG
TTGGGGGTGTTGGGTGAGGGGGATGAGGTGGTGTTGGGGCGGGTTGATGTGGTGCAGCCG
GTGTTGTGGGCGGTGATGGTGTCGTTGGCTGCGGTGTGGCGTTCGTGGGGTGTGGTGCCG
GCTGCGGTGGTGGGGCATTCGCAGGGGGAGATTGCGGCGGCGTGTGTGGCGGGGGGTTTG
TCGTTGGGTGATGGTGCGCGGGTGGTGGCGTTGCGGAGTCGGGCGATTGCGGGGGCGTTG
GCGGGTAGGGGTGGGATGGTGGCGGTGTCGTTGCCGGTGGAGGGTGTGCGGGGGTTGTTG
TCGGGGGGTTTGTCGGTGGCGGTGGTGAACAGTCCTGGTGGTGTGGTGGTGGCGGGTCCG
GTGGAGGAGTTGGATGCGTTGTTGGTGGTGTGTGAGGAGCGGGGGGTGCGGGCGCGTCGG
GTGCCGGTGGATTATGCGTCGCATTCGGTGTTTGTGGAGTTGATCGAGGATCGGGTGTTG
GCGGATTTGGCGGGGTTGGCGCCGGTGTCGGGTTCGGTGCCGATGTATTCGTCGGTGTCG
GGTGAGCGGGTGGATACGGCGGGTTTGGATGGGGGGTATTGGTATCGGAATTTGCGGCAG
ACGGTGGAGTTCGAGCGGGCGACGCGGGCGTTGGCGGCGGATGGTTTCTCGGTGTTTGTT
GAGGTGAGTCCGCATCCGGTGTTGACGGTGGCGGTGCAGGACACGTTGGGTGAGGGTGTG
GTGGCGGCGGGTACGTTGCGTCGTCATGAGGGTGGGTTGGACCGGTTCCTGTTGTCGGCC
GCGGAGCTGTTCGTGCACGGCGTCCCCGTGACGTGGAACGGTCTGTTCGCGGACCGGAAG
CCGCGGCCGGTGAGCCTGCCGACGTACGCCTTCCAGCACCAGCGGTACTGGCCGCAGCCT
TCGTTGGTGGCGGGGGACGTGGCGGCTGCGGGTCTGGTGTCGGCGGAGCATCCGTTGCTG
GGTGCCGTGGTGTCGGTGCCCGGCTCGGACACCGTGGTGTTGACGTCGCGGTTGTCGTTG
CGGGCGCAGCCGTGGTTGGGGGACCACGCGGTGCACGGGACGGTGATCTTCCCGGGGACG
GGGTTCGTGGAGCTGGCGATCCGCGGTGCGGACGCCGCCGGCGCGGGCCGGCTTCGGGAG
CTGATCGTGGAGGCGCCGCTGGCCGTTCCGGCCGGCGGAAGCGTCCAGGTCCAGGTGGTC
GCCGACGCCGAGGACCACACCGTCGCCGTCTACGCCCGAGCCGACGAGGACGAGCCGTGG
ACCCGGCACGCGATCGGCGCCGTCGACGACGAGACAGCGGGCGTGGACACCGCGGACCTG
GCCGGGGAGTGGCCGCCGGCGGGCAGCACGCCGGTGGACCTGGAGGACTTCTACCAGCGC
AGCGCCGACAGCGGGTTCGGCTACGGCCCGGTCTTCCAGGGCCTGACCCGGGCATGGCGC
CTCGACGGCCGTATCTACGCCGAGGCCGCCCTGCCCGACGACCAGGCGGCCGCCGCAACG
GCGTTCGGCATCCACCCGGCGCTGCTGGACGCGGCCCTGCACCCGAACACCTTCGCCGAC
CTCGAACCCACCGAACTCGGCCGGCTGCCCTTCACGTTCGACGACGTCACCCTGCACGCC
ACCGGCGCGAGGGCCGTACGGATACGGATGGCGCGCACGGGACCGGACTCCGTCACGGCC
GTCCTGGCCGACGAGACCGGCGCGCCCGTCCTGTCGATCGGCTCGCTGGTCATGCGTCCG
GTCCCGGAGCAGGTCCTCGGCGGGGCCCGGGCCCCGGAGACGATGCTCGCCCTGGTCTGG
AACGAGGTGCCGGACGCGTCCGGTGCGGCGGCCGGCGCGGAGCCCGGTGCGGCGCCCGCC
CAGGACGGCGACGTGCTGCTGGAGGTACCCGCCGCGGCCGACGGTTCACCGGAGTCGGTG
CACGCGGCCGTGGCGTGGACACTCGGGCAGTTGCAGGGCCTCAGCGGCGGCCGACTGGTC
GTCCTGACCCGCGGCGCGGTCGCCGCCCTGCCCGGCGAGACCGTCACCGACCTGGCCGCG
GCCGCCGTGTGGGGCCTGGTGCGGTCCGCGCAGAGCGAGGACCCGGGCCGGATCGTCCTG
GTCGACGCCGACGAGGGCACGCGGGCCACCCGCGACCTGCTGGCGCGCGTGGCCGGCACC
GGCGAGCCGCAGCTCGCGGTGCGTGAAGGCGCCCTGCTGGCACCCCAGTTGACGCGCACG
ACCGAGACCGGCGAGCCCGTCGCCCTGGACGGCACCGTCCTGATCACCGGCGGAACCGGC
GGCCTCGGCAGCGCGGTCGCCCGGCACCTGGTCGCCGCGTACGGCGTGCGCAGCCTCCTG
CTGCTCAGCCGCCGGGGCGGCACGGCCCCCGGCGCCGCCGAACTCGTCGAGGAGCTGACC
GCCCAGGGCGCCGAGGTCACGGTGGTCGCGTGCGACGCCGCCGACCGGTCGGCCCTGGCC
GAGGTGCTGGCGGGAGTGCCGCTCGCGGGAGTGGTGCACACCGCGGGCATCCTGGACGAC
GGCGTGATCTCCACGCTCACCCCGGAGCAGGTCCACCGCGTGCTGACCCCGAAGGTCGAC
GCCGCCTGGCACCTGCACGACCTGACCCGCGACCGCGACCTCGCGATGTTCGTGGTGTTC
TCCTCGCTCGCCGGACTCATCGGCAGCCCGGGACAGGGCAACTACGCCGCGGGCAACGTC
TACCTCGACTCCCTCGTGCAGCAGCGCCGCGCCGCCGGACTCGCCGGCATCTCCATGGCA
TGGGGACCGTGGGACCAGAGCCTGGGCCTCACCGGCGCGCTGTCCGGCACCGACATGCAC
CGCCTGGGCCGGCTCGGCATGCTCCCGATCTCGGAGGAGCAGGGGATGGCCCTGTTCGAC
CAGGCGCTCTCCGCCGGCCTGCCCCTGCTGGGACTGACCGAACTGAAGGCATCGGCCCTG
CGGGCCACGACCGAGGTCCCGGCGCTGTTCCGGTCGCTCGCCGGCGGCCCGGCGCGCCGG
ACCCGGGCCCGCGCGGGAGCCGCGGCGCCGGCGGCCGGCCTTGCCGGCAGGCTGGCCGGT
CTGACCCCCGAGCAGCGGCAGAGCCACCTGCTCGGCCTGGTCCGCGAGCACGCCGCCGCG
GTGCTGGGGCACGGCTCCGGCAGCCGGATCGCCGCGGAGCAGCCCTTCCGCGAGGTGGGC
TTCGACTCGCTGACCGCGGTCGAGCTGCGCAACCGGTTGCAGGCCGTGACGGAGCTGAGC
CTGCCGTCGACGCTCGTCTTCGACTACCCGAACGCGGTGCGTCTCGCCGGGTACGTGGGC
GAGCGCCTGGGCGGCGTCACCGCCGCTCCGGTCGACGCGCTGCCGGTGCTGCGGTCGGTC
GACGACGATCCGCTGGTCATCGTGGGCATGTCCTGCCGCTTCCCCGGCGGCGCTTCGGAC
CCGGACCGGTTGTGGGACCTGCTGGAGCAGGGCCGGGACGGCATGGGCGCGTTCCCCGGC
GACCGCGGCTGGGACACCGGCCTGCTGACGGAGCTGGCCCACGCGGGCGGGTTCGTGGAG
GGGGCGTTGGACTTCGATGCGGGGTTCTTCGCGATGTCGCCGCGTGAGGCGTTGGCGACG
GATCCTCAGCAGCGGTTGTTGTTGGAGGGGTCGTGGGAGGCGTTGGAGCATGCGGGGATT
GATCCGGTGTCGTTGGCGGGTTCGGCGACGGGGGTGTTCGTCGGTAGTTACCAGTCCGGT
TATGCGGAGGTGGTGTCGGCGGCGTTGGTGGATGCGGATGCGGATGCGCAGTTGTTGACG
GGTGGTGCGCAGAGTGTGTTGTCGGGGCGGGTGGCGTATGCGTTGGGGTTGGTGGGTCCG
GCGGTGACGGTGGACACGGCGTGTTCGTCGTCTTTGGTGGCGTTGCATTTGGCGGGTCAG
GCGTTGCGGGGTGGGGAGTGCTCGCTGGCGTTGGTGGCGGGGGTGACGGTGAATGCGTTG
CCGCACACGTTTGTGGGGTTCTCGCAGCAGGGTGGGTTGTCGGCTGATGGTCGGTGCAAG
GCGTTCGCGGAGGCGGCGGACGGGACGGGTTTCAGTGAGGGGATGGGGGTGTTGGTTGTC
GAGCGGTTGTCTGATGCGGAGCGGAACGGGCATCGGGTGTTGGCGGTGGTGCGGTCGAGT
GCGGTGAACCAGGACGGTGCGTCGAACGGGTTGACGGCGCCGAACGGTCCGTCGCAGCAG
CGGGTGATCCGCCAGGCGCTGGCGGCTGCGGGGTTGTCGTCGGGGGATGTGGATGTGGTG
GAGGGGCATGGCACGGGCACGACGCTGGGCGACCCGATCGAGGCTCAGGCGGTGCTGGCG
ACCTACGGCCAGGATCGGTCGGAGGAGCGGCCGTTGTTGTTGGGGTCGTTGAAGTCGAAC
ATCGGTCATACGCAGGCGGCTGCGGGTGTGGCGGGTGTGATCAAGATGGTGTTGGCGATG
CGGCATGGGGTGGTGCCGCGGACGTTGCATGTGGATGAGCCGTCGTCGCATGTGGACTGG
GGCCAGGGTCGGGTGCGGTTGCTGACGGAGTCGGTGGCTTGGCCGGAGAGCGGTCGTCCG
CGGCGGGCGGGTGTGTCGTCGTTCGGGATCTCGGGGACGAACGCGCACGTGATCTTGGAG
GCGGCGCCTGGGGTGGAGGCCGAGGTCGAGGTCGTGGAAGGGGATGGGGCCGAGTCCGGG
TCCGAGTCCGGGTCGGGGTCGGTGTGGGTGGTGTCGGGTCGTTCGGAGGGGGCGTTGCGG
GCGCAGGCGGAGCGGCTGTTGTCGGCGGTGTCGGAGGCGGAGTCGTGGGGCTCGGCGGCG
GTGGGTGCGGCGTTGTTGTCGCGGTCGGTGTTCGACCATCGTGCGGTGGTGGTGGGTGCG
GATCGGGCTGAACTCGTGGCAGGTTTGGGGGCGTTGGCGTCGGGGGAGCCGGGTGCTCTG
GTGGCGCAGGGTGTGGCGCGGAGTGGTCGTCGGGTGGCGGTGTTGTTCGCGGGTCAGGGT
GCGCAGCGGCTGGGGATGGGCCGCCGGCTGCACGAGGAGTCGCCGGTGTTCGCGGCGGCC
TTCGACGAGGTGGTGGCGGAGTTGGACCGGCACCTCGAGGCGCCGTTGCGGGAGGTGCTG
TGGGGCGAGGACGCCGAGGCGTTGAACTCCACCGGTTGGGCGCAGCCGGCGTTGTTCGCG
GTCGAGGTGGCGCTGTTCCGGCTGTTGGAGTCGTTCGGCGTCACACCGGATTACCTGTTG
GGGCACTCCATCGGTGAGGTGGCGGCCGCGCATGTGGCCGGGGTGTTCGATCTGGTGGAT
GCGTGTCGGTTGGTGGGGGCGCGGGCGCGTTTGATGCAGGCGCTTCCGGTGGGTGGGGCG
ATGGTGGCGGTTGCCGCGCCGGAGGAGGAGGTGCTGCCGCATCTGTCGGACGGGGTGTCG
GTGGCGGCGGTGAACGCGCCGGGTTCGGTGGTGGTCTCCGGTGAGGAGGGCGCGGTCTTG
GAGGTCGGTGAGCACTTCAAGGCGCTGGGGGTGAAGACGACCCGGCTGCGTGTCTCGCAC
GCCTTCCACTCGGCGTTGATGGAGCCGATGGTGGACGACTTCCTGGCGGCGATCGCGGAT
GTGTCGTTCTCCGAGCCGCGGATTGCGGTGGTGTCGAATCTGACGGGTGAGCCGGCGGAT
ATGACGTCGCCGAAGTACTGGGCGCAGCAGGTGCGTTCGGGGGTGCGGTTCGCGGACGGT
GTGGCGTGGTTGACGGCGCAGGGTGTGGACGTGTTCGTGGATGCGGGTCCTGATGGTGTG
GTGGCGGGTCTGGCGCAGGCCAACGCGTCGGATGCGGTGGCGGTGGCGTTGATGCGCAAG
GACCGTGGTGATGTGCGGACGGTGTTCCACGCGGTGGGGCAGTTGTTCGTGGAGGGTGTG
CCGGTCGCGTGGGAGACGTTGTTCGCCGGTGCGGGGTCCCGTCGGGTGGATCTGCCGACG
TATGCGTTCCAGCGCCGCCGTTACTGGCCGCAGGCGTCCCTCGCGGGCGGTGATGTGGCG
GCTGCGGGTCTGGTGTCGGCGGAGCATCCGTTGCTGGGTGCGGTGGTGTCGGTGCCGGAG
TCGGGGACGGTGGTGTTGACGTCGCGGTTGTCGTTGCGGGCGCAGCCGTGGTTGGGGGAT
CACGCGGTGCACGGGACGGTGGTCTTCCCGGGGGCGGGGTTCGTGGAGTTGGCGATCCGC
GGTGCGGATGCGGTGGGTGCGGGTGGTCTGCGGGAGTTGGTCGTGGAGGCGCCGTTGGTG
GTGCCTGCGGTCGGCAGTGTTCAGGTGCAGGTGGTGGTCGGAGATGGTGGGTCCTTGACG
GTGTATGCGCGTGCCGCGGACGAGGAGCCGTGGACGCGGCATGCGACCGCGGTGCTCGGG
GATGCCCTGCCCGCGGACGCGGACGCGGACGCGGTGGGTGCGGGTGCGGGTGGGTGGCAG
TGGCCGCCGGCCGACGCCTCGTCCGTCGACGTCTCGGACTTCTACCCCTCCCTCGCGGAC
GAGGGGTTCGCCTACGGTCCGGCCTTCCAGTGGCTGCGGCAGGTGTGGGTCGGACCGGAG
GAAGTGTTCGCCGAGGTGGCCGTGGCGGACGAAGCGGCCGACCAGGCACGGAAGTTCGGT
GTGCACCCCGCTCTGCTGGACGCGGCGCTCCAGGCGAGTACCTTCGCGGGCCTCGACCCC
GCGCCGGCCGGCCGGATGCCGTTCAGCTTCGCCGACGTGACCCTGCACGCGGGCGGCGCG
ACGGCGACCCGGGTGCACATGGTGCGTACCGGCCCCGACAGCGTCAGCGTCGAACTGGCC
GACGGCAACGGTGACCCGGTGCTGACGATCGGGACGCTGGTGCTCCAGCCGGTCACGGCG
ACCGGTCCGGTCGGCGGCGCGCAGGCGGGTGCGGTGCTGGCGGTCGACTGGTCGTCGGTG
GTCGCCTTGGACGAGGCGGCCGGGCCCGGGGCGCCCCTTCGGGTGGTGGGCGCCCCGGAG
GACCTCGTCGTGGAGGATCTGGTTCCGGGTGAGGTCGTGGTGTTGGAGGCGGTCGGTACG
GCGGGTGAGGTGGTGGGTTCGGCTCATGGGTTGGCTGGTTGGGTGTTGGCGCAGGTGCAG
GGGTGGCTTGGGGATGAGCGGTGTGCGGAGGGTCGGTTGGTGGTGGTGACGCGGGGTGCG
GTGTCGGCGGTGCCGGGGGAGGTGTTGGCGGATGTGGCGGCGTCGGCGGTGTGGGGTCTG
GTGCGTTCGGCGCAGGCGGAGAATCCGGGGCGGATCACCTTGCTGGACCTTGGTGCCGGT
GAGGGGGTCGGGTCGGTCGACCGTGCTGTGGTGGTCGGGGCGGTGAATTCCGGTGAGCCG
CAGCTCGTGGTCCGCGACGGTGTGGTGCGGGCCGCGCGCCTGGTCCGTGTCGCGGCTGCG
GCCGACGGGGACGCGGGGTCGGTGGGCTTTGGTGCGGGCACGGTGCTGGTCACGGGTGGT
ACGGGTGGTCTGGGCCGTGAGGTGGCGCGTCACCTGGTGGCTGTGCACGGGGTGCGGAGT
CTGCTGCTGCTGAGTCGTCGGGGTCTGGCGGCCGAGGGTGCACGGGAGTTGGTCGAGGAG
TTGGGCGCGCTGGGCGCGGAGGTCGTGGTCGGGGCGTGTGACGTCGCGGATCGTGCGGCG
CTGGCGGAGGTGCTCGCGGGTGTGCGGCTGACGGGTGTGGTGCACACGGCTGGTGTGGTG
GATGACGGTCTGGTGTCGTCGTTGACCGTCGAGCGGTTGGATCGGGTGTTGGCGCCGAAG
GTGGATGCGGCGTGGTATTTGCACGAGTTGACGGCGGGGATGGATCTGTCGGCGTTCGTG
GTGTTCTCGTCGTTGGCCGGTGTGGTGGGTAGTCCGGGGCAGGGGAACTACGCGGCGGGC
AATGTGTTCTTGGACGCGTTGATGCAGTATCGGCGGCTGGAGGGGTTGCCGGCGGTGTCG
ATGGCCTGGGGTCCGTGGGCCCAAGGTGCGGGTCTGACGGGTGAGTTGTCGGATGTCGAC
ATGCGGCGGATCGCCGCGTCGGGAACGCCGCCGTTCACGGTGGAGCAGGGCCTGGCGGTG
TTCGACGCGGCTCTGGGCAGTCCGGAGGCGGCCGTCGCCCTGACCCGGCTCGACCTCGCG
GCACTGCGGACCCGCGACGAACTGCCCCCGCTCTGGGGCCTGCTCGCCGGCAAGCGCGGT
CGGCCGGTGGCGAGCGACCGCCGCCAGGAGTCCGGCACCCTCGCCGACCGCCTGTCGGCC
CTGGCCCTTCCGGAGCGTACGGACCAGCTCCTCGTTCTGGTCCGCGACCACGTCGCGGCG
GTGCTCGGCTTCGCCTCCCGCGAGCAGATCGACACCACCCAGGCGTTCCGGGAGCTGGGC
TTCGACTCGCTCAGCGCCCTCGAACTGCGCAACCGGTTGCAGACGGCGACGGGACTCACC
GTCTCGTCGACCCTGGTCTTCGACTACCCCAACCCGCAGCGTCTCGCCGCGCACCTCGCC
GAGCAGTTCGGTACGGCGGGGGGAGCGGAGACCGGAGCGGCCGCGCTGCTGGCCCAACTG
GACGCGCTCAGCAGCACGTTGGCCCGGGCGGACGTCGTCGACGAGGACCGCGAGGCCATC
GCGCACCGGCTTCGCTCGATGCTCGACACGTGGCGTTCCCCCGAAGAGGAGAACGCCGAC
GAGGACTGGGAGACCCCCGACGAGGTCTTCCGCTTCATCGACGACGAACTCGGTATTTCC
GAAAGCGAAGTGTGA
[0] KSQ8..381
[0] AT546..886
[0] methylmalonyl-CoA734..738
[0] ACP963..1033
[1] KS1057..1430
[1] AT1588..1894
[1] malonyl-CoA1773..1777
[1] dh1942..2095
[1] KR2420..2596
[1] ACP2695..2765
[2] KS2788..3162
[2] AT3337..3649
[2] methylmalonyl-CoA3525..3529
[2] DH3697..3855
[2] KR4131..4307
[2] ACP4410..4480
[3] KS4503..4872
[3] AT5035..5341
[3] malonyl-CoA5220..5224
[3] DH5389..5552
[3] KR5853..6029
[3] ACP6130..6200
[0] KSQ22..1143
[0] AT1636..2658
[0] methylmalonyl-CoA2200..2214
[0] ACP2887..3099
[1] KS3169..4290
[1] AT4762..5682
[1] malonyl-CoA5317..5331
[1] dh5824..6285
[1] KR7258..7788
[1] ACP8083..8295
[2] KS8362..9486
[2] AT10009..10947
[2] methylmalonyl-CoA10573..10587
[2] DH11089..11565
[2] KR12391..12921
[2] ACP13228..13440
[3] KS13507..14616
[3] AT15103..16023
[3] malonyl-CoA15658..15672
[3] DH16165..16656
[3] KR17557..18087
[3] ACP18388..18600

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [536-665]  G3DSA:3.40.366.10 [734-876]  G3DSA:3.40.366.10 [1576-1708]  G3DSA:3.40.366.10 [1773-1884]  G3DSA:3.40.366.10 [3332-3459]  G3DSA:3.40.366.10 [3525-3637]  G3DSA:3.40.366.10 [5025-5155]  G3DSA:3.40.366.10 [5220-5331]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [991-1006]  PS00012 [2723-2738]  PS00012 [4438-4453]  PS00012 [6158-6173]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [963-1038]  4.69999999999992e-80 G3DSA:1.10.1200.10 [2693-2768]  4.69999999999992e-80 G3DSA:1.10.1200.10 [4407-4484]  4.69999999999992e-80 G3DSA:1.10.1200.10 [6128-6203]  4.69999999999992e-80 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [963-1033]  PS50075 [2695-2765]  PS50075 [4410-4480]  PS50075 [6130-6200]  PS50075
PS50075   ACP_DOMAIN
 [956-1073]  2.49999811956465e-26 SSF47336 [2688-2804]  7.10001443313148e-24 SSF47336 [4403-4519]  7.49999605851445e-26 SSF47336 [6123-6221]  9.59999914716171e-22 SSF47336
SSF47336   ACP_like
 [966-1032]  1.7e-11 PF00550 [2699-2764]  1.6e-09 PF00550 [4414-4479]  4.40000000000001e-09 PF00550 [6134-6199]  6.70000000000001e-13 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [2420-2595]  4.39999999999997e-59 PF08659 [4131-4306]  7.59999999999998e-61 PF08659 [5853-6028]  1.2e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [8-256]  3.50000000000004e-83 PF00109 [1057-1304]  1.9e-82 PF00109 [2788-3036]  5.59999999999999e-92 PF00109 [4503-4746]  1.39999999999997e-78 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [264-381]  3.99999999999998e-39 PF02801 [1312-1430]  2.89999999999999e-47 PF02801 [3044-3162]  1.2e-48 PF02801 [4754-4872]  2.89999999999999e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [546-886]  4.40000000000003e-105 PF00698 [1588-1894]  4.10000000000004e-61 PF00698 [3337-3649]  3.39999999999996e-95 PF00698 [5035-5341]  1.5e-61 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [543-829]  5.50001754266469e-67 SSF52151 [1583-1889]  4.89996723796399e-69 SSF52151 [3335-3633]  1.90000694315261e-63 SSF52151 [5030-5336]  2.2999842048857e-69 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [668-733]  3.0999994589937e-18 SSF55048 [1710-1772]  9.59999914716171e-17 SSF55048 [3462-3524]  6.39998633403535e-17 SSF55048 [5157-5219]  9.00000407957274e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [8-267]  G3DSA:3.40.47.10 [268-432]  G3DSA:3.40.47.10 [1057-1315]  G3DSA:3.40.47.10 [1318-1482]  G3DSA:3.40.47.10 [2791-3048]  G3DSA:3.40.47.10 [3050-3212]  G3DSA:3.40.47.10 [4503-4757]  G3DSA:3.40.47.10 [4760-4923]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [7-431]  6.19996040581186e-90 SSF53901 [1049-1428]  1.79999754022378e-92 SSF53901 [2780-3160]  2.1000026783403e-100 SSF53901 [4495-4870]  1.39999277195148e-91 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2420-2602]  4.30000000000003e-111 G3DSA:3.40.50.720 [4131-4313]  4.30000000000003e-111 G3DSA:3.40.50.720 [5853-6068]  8.80000000000003e-103 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1217-1233]  PS00606 [2949-2965]  PS00606 [4659-4675]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [547-867]  2.7000136937899e-119 SM00827 [1588-1875]  9.30000048475962e-113 SM00827 [3339-3630]  4.30000170645869e-108 SM00827 [5035-5322]  5.89998809405682e-114 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [964-1036]  8.5999877623955e-32 SM00823 [2696-2768]  2.70000183580794e-27 SM00823 [4411-4483]  3.69999438558106e-32 SM00823 [6131-6203]  6.99997659850661e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1942-2095]  1.60000240695997e-62 SM00826 [3697-3855]  2.39999798157263e-73 SM00826 [5389-5552]  4.89996723796399e-72 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [10-434]  SM00825 [1059-1482]  SM00825 [2790-3214]  SM00825 [4505-4924]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2420-2596]  3.89999861795218e-58 SM00822 [4131-4307]  2.9000035467798e-59 SM00822 [5853-6029]  7.49999605851445e-59 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit