close all open/close all

CDS information : Rever_00240


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction71,116 / 92,208 / + [in whole cluster]
71,116 / 92,208 / + [in contig]
Location71116..92208 [in whole cluster]
71116..92208 [in contig]
TypeCDS
Length21,093 bp (7,030 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)revD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionPKS/NRPS Module

9 methylmalonyl-CoA
10 malonyl-CoA
11 methylmalonyl-CoA
12 malonyl-CoA
KS35..402
AT576..888
DH936..1094
KR1404..1580
ACP1681..1751
KS1774..2143
AT2329..2635
DH2684..2841
KR3141..3313
ACP3410..3484
KS3509..3883
AT4054..4366
KR4650..4830
ACP4928..4998
KS5022..5397
AT5565..5871
DH5918..6074
KR6386..6558
ACP6660..6730
TE6809..7021

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MTQSSDKIVEALRASLLENQRLRKEHQDLADAVSEPLAIVGMACRFPGGVEDPEGLWRLV
AEGGDAVGGFPTDRGWDTELLHDIPNGGGFLADASGFDAEFFGISPREALATDPQQRLLL
EASWAALEHAGLDPRKAAGTPTGVFIGAAPYGYSDVMSGSSDDLQGHVLTGNAPAVVSGR
VAYTLGLEGPAVTVDTACSSSLVALHLAGHSLRAGECSMALVGGVTVMATPGTFVEFSRQ
GGLSSDGRCRAFADAADGTGWSEGVGVLVVERLSDAQRNGHRVLAVVRASAVNQDGASNG
LTAPNGPSQQRVIRTALAAAELSSADVDVVEAHGTGTTLGDPIEAQALLSTYGQDRPEDR
PLWLGSLKSNIGHTQAAAGVAGVIKMVLAMRHGVLPQTLHVDQPSTHVDWSRGQVRLLTE
SVAWPENGRPRRAGVSAFGMSGTNAHVILEAPEVAADAEAEVGVVPGVQDEPAAGAGGAA
PVAWVVSGRSAAAVRGQAGRLLAAVESSESPEWSGSVEPVDVGAALLSRSLFDHRAVVVG
SGREELVAGLSSLAAGEPAGNVVADGVRSGAGRRVVFVFPGQGAQWVGMAAGLLESSSVF
RESMELCGEALRPFVEWDLLGVLGEGDEVVLGRVDVVQPVLWAVMVSLAAVWRSWGVVPT
AVVGHSQGEIAAACVAGGLSLGDGARVVALRSRAIAGALAGRGGMVAVSLPVEGVRGLLS
GGLSVAVVNSPGGVVVAGPVEELDALLVVCEERGVRARRVPVDYASHSVFVELIEDRVLA
DLAGLAPVSSGVPMYSSVSGERVDTAGLDGGYWYRNLRQTVEFERATRALAADGFSVFVE
VSPHPVLTVAVQDTLGEGVVAAGTLRRHEGGLDRFLLSAAELFVRGVPVAWDGLFAGRRT
RRVDLPTYAFQRRRYWPQPSLVAGDVAAAGLVSAEHPLLGAVVSVPESGTVVLTSRLSLR
AQPWLGDHAVHGTVIFPGTGFVELAIRGADAAGAGRVRELIVESPLVVPERDSVQVQVVV
DAEDHTVAVYARAGEDEPWTRHASGSTGTEALAVEAGEFAGEWPPAGSTPVDLEDFYQRS
ADSGFGYGPVFQGLTRAWRHNGDILADIALPQDERTGAGAFGIHPALLDAALHPSTFADL
EPTELGRLPFAFNDVTLHATGATRVRARITPAGPDAVALELADEAGQPVLSIGSLVLRPL
TAQTLAGEARPGAMLALDWVEVPAPEAGVQDGGFTVVRGPAGATPAAVATDDADSDADSD
AGTDAEPSDLVVLEVAPEGDQVVEAVHATANWVLGRLQAFTGTRMAVVTRGAVAAGPGET
VTDLAAASVWGLVRSAQTEDPGRFVLLDIAPDAAPDAVLDAALVARAFAADEPQLALRGE
VFRSPRFTRVPGSEEEPAPVALDGTVLVTGGTGGLGREVARHLVARHGARDLLLLSRRGG
DAEGAAELVEELAAQGARATVAACDVADREALAAALAGTKLAGVVHTAGILDDGTVASLT
ADQMDRVMRPKVDAAWHLHELTRDADLRVFAVFSSFSGQIGSPGQGNYAASNMFLDALME
QRRQDGLPGVSMAWAAWTQEVGLTGTLSEVDMRRIARSGVPPLTVEQGLSLFDQALAADR
PVLALARLDLPRLRAQGELPAVLRGLVPGPVRRAVAAQEVRGDGFAQRMAALPAQERAAH
LLTLVRDHVASVLGYPSGADIDEAKPFREIGFDSLTAVELRNRLQAVTGLGLPSTLVFDY
PTAVRLAEYVGERLGGVSAVPVDALPVLRSVDDDPLVIVGMSCRFPGGVWNPDGMWDLLA
QGRDAMTRFPGDRGWDTGLLTELAHAGGFVDGAMDFDAGFFAMSPREALATDPQHRLLLE
GSWEALEHAGIDPVSLAGSATGVFVGSYQSGYSEVAGEAMTDSDANAQLLTGGAQSVLSG
RVAYALGLVGPALTVDTACSSSLVALHLAGQALRGGECSLALVAGVTVNALPHTFVGFSQ
QGGLSADGRCKAFAEAADGTGFSEGMGVVVVERLSDAERNGHRVLAVVRSSAVNQDGASN
GLTAPNGPSQQRVIRQALAAAGLDAADVDAVEAHGTGTTLGDPIEAQAVLATYGQDRPED
RPLWLGAVKSNIGHTQAAAGVAGVIKMVLAMRHGLLPQTLHVDEPSTHVDWEQGRVRLLT
EATPWPDSGRPRRAGVSSFGISGTNAHVILEAAPGTEAATGAQTGMATGTGTTGTGTTGT
GATGVEAAASASGADTVPEHASETVWVVSARTEAALRAQAERLLSATEGLDPADVGAALL
SRSAFDHRAVVVGADRSELVSGLRALAAGEAAGNAVEGVARSGRRVAVLFTGQGAQRLGM
GRRLHGESPVFAAAFDEVVAELDRHLDVPLREVVWGEDAEALNSTGWAQPALFAVEVALF
RLLESFSITPDYLLGHSIGEVAAAYVAGVFELADACRLVAARARLMQALPAGGAMVAVAA
SEDDVLPLLSDGVSVAAVNAPGSVVVSGEESAVLAVGEHFKALGVKTTRLRVSHAFHSVL
MEPMLDDFLAAIADVSFSEPQIPVVSNLTGEPADMTSPKYWAQQVRSAVRFADGLAWLTA
HGVDAFVEAGPDAVLAGLVDLNGAAGATAVALQRGDRTGGQVAHHAVGRLYVHGVPVRWD
VLFTGREPRWVDLPTYAFQRRRYWPQASLAGGDVTAAGLASAEHPLLGAVVSVPESDTVV
LTSLLSLRTQPWLADHAVQGTVILPGTGFVELAIRGADAVGAGGLRELIVEAPLVVPASD
SVQVQVVVDGGTAVVYARPAGDEPWTRHATAVLGEALPAGAGAGAGGWQWPPADVSSVDV
SDFYDRMAEGGFVYGPAFRGLRRVWQAEGEVFAEVAVGEEETDRARRFGVHPALLDAALQ
ASAFVGLDPAPAGRLPFSFGEVTLHAGGAVASRVRVARTGADSVRVELADGNGDPVLTIG
SLVMRPVAAGGVAGGVRSGAVLAVDWSSVVALDEAAGPGAPLRVVGAPEDLVVEDLVPGE
VVVLEAVGTAGEVVGSAHGLAGWVLAQVQGWLGDERCAEGRLVVVTRGAVSAVPGEVLAD
VAASVVWGLVRSAQAENPGRIVLLDLDQRASAVDAGLVAGVVAAGEPQAVVRDGVVRAAR
LVRVAAAADGDAGGEVGFGAGTVLVTGGTGGLGREVARHLVAVHGVRDLLLLNRSGGGAE
LVAELAELGARARVVACDVADRVALAEVLAGVRLTGVVHTAGVVDDGLVSSLTVERLDRV
LAPKVDAAWYLHELTAGMDLSAFVVFSSLAGVVGSPGQGNYAAGNVFLDALMQYRRLEGL
PAVSMAWGPWAQGAGLTGELSDVDMRRIAASGTPPFTVEQGLAVFDAALGSPEAAVALTR
LDLAALRTRDELPPLWRTLVGQPARRAAGDHRAAPDDLAHRLAGRSLADREEDLLALVAD
HVAAVLGYASREQIDTAQAFRDMGFDSLSAIELRNRLQAATGLTVPATLVFDYPNARRLA
AYLAEQFGDAPRGSAVALPPLVSVDDDALVIVGMACRFPGGVRDIDGFWQLVANGGDGMS
PFPADRGWDLEALYDPAGDRSGTSATREGGFLDDALDFDAGFFGISPREALVTDPQQRLL
LETSWEALEHAGIAPERLAGSSTGVFVGSYQSGYSEVIGDALDEAEPQMLTGNAQSVLSG
RVAYTLGLEGPAVTVDTACSSSLVALHWAGQALRAGECSLALVGGVTMMATPSTFVSFSQ
QGGVASDGRCKAFADGADGTGWSEGVGVLVVERLSDAERNGHRVLAVVRASAVNQDGASN
GLTAPNGPSQQRLIRQALAAAGLNSGDVDAVEAHGTGTSLGDPIEAQAVLATYGQDRPED
RPLWLGAVKSNIGHTQAAAGVAGVIKMVLAMRHGVLPQTLHVDEPSTHVDWSQGQVRLLT
EATPWPENGRPRRAGVSSFGISGTNAHVILEAPEVEAEAEAEVGVVPGVQDEPAAGAGGA
APVAWVVSGRSAAAVRGQAGRLLAAVESSGSAGSVEPVDVGAALLSRSLFDHRAVVVGSD
REQLVSGVRALAAGEPAGNLVGGAAGGGQERRVVFVFPGQGAQWVGMAAGLLNSSSVFRE
SMELCGEALRPFVEWDLLGVLGEGDEVVLGRVDVVQPVLWAVMVSLAAVWRSWGVVPAAV
VGHSQGEIAAACVAGGLSLGDGARVVALRSRAIAGALAGRGGMVAVSLPVEGVRGLLSGG
VSVAVVNSPGGVVVAGPVEELDALLVVCEERGVRARRVPVDYASHSVFVELIEDRVLDDL
AGLAPVSSGVPMYSSVSGERVDTAGLDGGYWYRNLRQTVEFERATRALAADGFSVFVEVS
PHPVLTVAVQDTLGEGVVAAGTLRRHEGGLDRFLLSAAELFVHGVPVTWNGLFADRKPRR
VDLPTYAFQRRRYWPQQSSAVGDAALRDPVDAEFWASMQSTDVSDLARSLGVDSTTLSDV
VPAMLRWRDQRQSESQADGWRYRETWAPVSATGRPLDPSAARWAVIVPEGHADDPWSAAV
AEAVGGELIEDDGSAPELSPACPGVLSLLSARDDVEGLLSTVRLVQHLRAPVWAVTRGAV
AVRPEERVSGVWQGATWGIGRVAALELSERWAGLLDLPDVIDDAVRERLRTVVAGGHGED
QVAVRSSGLFARRLVHAAAPTLPASWRTSGTAIVTGGTGGVGAHVARWLVRVGAEHVVLV
SRRGPAADGARELSAELEAAGARVSVVAGDVGDRDTLAELIASVPAELPLRSVLHAAGVV
DEAGAVETLTAEALQAQLRVKVAGGLLLDELTQDLELDAFVLFSSGAAAWGSAGQGSYAA
ANACLDALAGHRRARGLTALSVAWGAWDAPGMMAADADYAQYLERLGVHPMQPEAAVAAL
HRALSDGDTNVTVTNMDWSRFVPAFGMARPSRLFSLLPEAAATADPEEQEEGVDHLRSMT
ARERRDHLLAAARDHAAAVLGYDSGDQVDAAQAFKELGFDSVTAVEFRNRLQTVTGLSLP
TTLVFDYPNAGRIADYLAERFGDTSAQAEDALPALVAGSTDDPMVIVGMACRFPGGVNNP
ADLWRVVTDGVDVMSGFPDDRGWDLDALYDPNGERAGSSVTREGGFLEDAGGFDAGFFGI
SPREAMATDPQQRLVLEASWEALEHAGIDPAALAGTATGVFIGAAPSGYSEVAGATPEAQ
GHLLTGGLLSVLSGRVAYTLGLQGPAVSVDTACSSSLVALHWAGQALNSGECSLALVGGV
AVMATPGGFVEFSRQGGLAANGRVKAFAEAADGTAWSEGVGVVVVERLSEARRNGHRVLA
VVRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAASLAPSDVDVVEAHGTGTTLGDPIEA
QALLATYGQGRPEERPLLLGSLKSNIGHTQAAAGVAGVIKMVLAMQNGVVPRTLHVDAPS
SQVDWSAGSVELVTGEMAWPESGRPRRAGVSSFGVSGTNAHVILEAAPGVEVEAEVEARV
EVAGEAGAESESESESGSGSVWVVSGRSEGALRAQAERLLSVAEGLDPVDVGGALLSRSV
FEHRAVVVGSGREELTAGLRALAAGEAAGNAVEGVARSGRRVAVLFAGQGAQRLGMGRRL
HGESPVFAAAFDEVVAELDRHLDVPLRGVVWGGDADALNSTGWAQPALFAVEVALFRLLE
SFGITPDYLLGHSIGEVAAAHVAGVFDLADACRLVGARARLMQALPVGGAMVAVAAPEEE
VLPHLSDGVSVAAVNAPGSVVVSGEESAVLAVGEHFKALGVKTTRLRVSHAFHSALMEPM
VDDFLAAIADVSFSEPRIAVVSNLTGEPADMTSPKYWAQQVRSGVRFADGVAWLAAQGVD
VFVDAGPDGVVAGLAQANASDAVAVALMRKDREGLAMALLAAGDLFVHGVPVEWVGLTGG
RGSEWVELPTYAFQRRRYWAQPKPVGDVAAAGLVSAEHPLLGAVVSVPESGTVVLTSRLS
LRAQPWLGDHAVHGTVVFPGAGFVELAIRGADAVGAGGLRELVVEAPLVVPAVGSVQVQV
VVGDGGSLTVYARAADEEPWTRHATAVLGDALPADVVAGGWQWPPADASSVDVSDFYELT
ADHGFVYGPAFRGLRQVWQAEGEVFAEVAVGEEETDRARRFGVHPALLDAALQASAFVGL
DPAPAGRLPFSFGEVTLHAGGAVASRVRVARTGPDSLRVELADGNGDPVLTIGSLVMRPV
AAGGVVGGAQAGAVLAVDWSSVVTLPEVDAGADTGTGTDAGMSVGVDGGVAVFRAPEDVV
PGEVVVLEAVGTAGEVVGSAHGLAGWVLAQVQGWLGDERCAEGRLVVVTRGAVSAVPGEV
LADVAASVVWGLVRSAQAENPGRITLLDLGAGEGVGSVDRAVVVGAVASGEPQLVVRDGV
VRAARLVRVAAAADGDAAGSVGFGAGTVLVTGGTGGLGREVARHLVAVHGVRDLLLLNRS
GGGAELVAELAELGARARVVACDVADRAALAEVLAGVALTGVVHTAGVVEDAVITSLDTE
RLDRVLAPKVDAAWYLHELTAGMDLSAFVVFSSLAGVVGSPGQGNYAAGNVFLDALMQYR
RLEGLPAVSMAWGPWAQGAGLTGELSDADMRRITASGTPPFTVEQGLAVFDAALGSPEAA
VALTRLDLAALRTRDELPPLWRTLVGQPARRAAGGHRNDPDDLARRLAALPDADARDAYL
LRLVADHVALVLGHAPGDGVDTTKEFRELGFDSLTSVDLRNRLQATTGMSLPATLVFDHP
DAATLAAFLSARFGDAGPAAAEPEAVAPRDPMQDLYLNALESGRADLGDAFALSAARLRP
RYADATALERRPVPVRLSAGDTGPHLVCVCPPLALNGPQTYNRFAAELAADWKVSALVAP
GFAADAPLPENSRVLIATLADAVQEYVGDSAFALAGLSSGGVLAHEIARELERRGSDPLA
VVLLDSYPMDSPVLKRWKNEMARVGLERARALDRRQADEGFRLEEITASAWICGELLLDW
RPEGLTAPSCLVRASEPVVAEDGAGWQTPVAASEVIDVPGDHFSIMDRQFAASTAAAVRA
WLAGVTARVG
selected fasta
>polyketide synthase [polyketide synthase]
ATGACTCAGTCCTCGGATAAGATCGTTGAGGCGCTGCGCGCGTCGCTTCTGGAGAACCAG
CGTCTTCGCAAGGAGCACCAGGACCTCGCGGACGCGGTGAGCGAGCCACTGGCGATCGTG
GGCATGGCCTGCCGGTTCCCCGGTGGTGTCGAGGACCCCGAGGGCCTGTGGCGCCTGGTC
GCCGAGGGAGGCGACGCGGTCGGCGGCTTCCCGACCGACCGTGGCTGGGACACCGAGCTG
CTGCACGACATCCCCAACGGCGGGGGGTTCCTCGCCGACGCCAGCGGGTTCGACGCCGAG
TTCTTCGGCATCTCGCCCCGCGAGGCCCTGGCCACCGACCCGCAGCAGCGGCTGCTGCTG
GAGGCGTCCTGGGCGGCGCTGGAGCACGCGGGCCTCGACCCCCGCAAGGCGGCGGGCACT
CCGACCGGCGTCTTCATCGGCGCCGCGCCCTACGGCTACAGCGACGTCATGAGCGGGTCG
TCCGACGATCTCCAGGGCCATGTGCTGACGGGCAACGCTCCCGCCGTCGTCTCCGGCCGG
GTGGCGTACACGCTGGGCCTGGAGGGTCCGGCGGTGACGGTGGACACGGCCTGCTCGTCG
TCGCTGGTGGCACTGCACCTGGCCGGCCACTCGCTGCGGGCCGGCGAGTGCTCGATGGCA
CTCGTCGGCGGTGTGACGGTGATGGCGACGCCGGGCACCTTCGTGGAGTTCAGCCGGCAG
GGCGGTCTGTCGTCCGACGGGCGGTGCAGGGCGTTCGCGGACGCCGCGGACGGCACCGGC
TGGTCCGAGGGCGTCGGTGTGCTGGTGGTGGAGCGGCTGTCGGACGCACAGCGCAACGGG
CACCGGGTCCTCGCCGTGGTGCGCGCCAGCGCGGTGAACCAGGACGGCGCGTCCAACGGC
CTGACGGCGCCGAACGGCCCCTCCCAACAGCGCGTGATCCGCACGGCGTTGGCGGCCGCG
GAACTGTCGTCCGCCGATGTGGACGTGGTGGAGGCGCACGGAACCGGTACGACGCTGGGC
GACCCGATCGAGGCGCAGGCGCTGCTGTCCACGTACGGCCAGGACCGTCCGGAGGACCGG
CCGTTGTGGCTGGGGTCGTTGAAGTCGAACATCGGTCATACGCAGGCGGCGGCGGGTGTC
GCCGGGGTGATCAAGATGGTGCTGGCGATGCGGCACGGGGTGCTGCCGCAGACGTTGCAC
GTGGACCAGCCGAGCACGCACGTGGACTGGAGCCGTGGGCAGGTGCGGCTGCTGACGGAG
TCGGTGGCCTGGCCGGAGAACGGCCGCCCGCGCCGGGCCGGTGTGTCCGCGTTCGGGATG
TCCGGGACGAACGCGCACGTGATCCTGGAGGCTCCCGAGGTAGCGGCCGACGCCGAGGCC
GAGGTCGGAGTCGTTCCGGGTGTTCAGGACGAGCCGGCCGCGGGTGCGGGTGGGGCTGCT
CCGGTGGCGTGGGTGGTGTCGGGGCGTTCGGCGGCCGCGGTGCGGGGTCAGGCGGGTCGT
CTGCTGGCGGCTGTGGAGTCGTCGGAGTCGCCGGAGTGGTCGGGTTCGGTGGAGCCGGTG
GATGTGGGTGCGGCGTTGTTGTCGCGTTCGCTGTTCGACCACCGGGCGGTGGTGGTGGGT
TCGGGGCGTGAGGAGTTGGTGGCCGGGTTGTCGTCCCTGGCGGCGGGTGAGCCGGCGGGG
AACGTGGTCGCGGATGGGGTGCGGTCCGGTGCGGGTCGTCGGGTGGTGTTCGTCTTTCCG
GGTCAGGGTGCGCAGTGGGTGGGTATGGCGGCGGGGTTGTTGGAGTCGTCGTCGGTGTTT
CGGGAGTCGATGGAGTTGTGTGGGGAGGCGTTGAGGCCTTTTGTGGAGTGGGATTTGTTG
GGGGTGTTGGGTGAGGGGGATGAGGTGGTGTTGGGGCGGGTTGATGTGGTGCAGCCGGTG
TTGTGGGCGGTGATGGTGTCGTTGGCTGCGGTGTGGCGTTCTTGGGGTGTGGTGCCGACT
GCGGTGGTGGGGCATTCGCAGGGGGAGATTGCGGCGGCGTGTGTGGCGGGGGGTTTGTCG
TTGGGTGATGGTGCGCGGGTGGTGGCGTTGCGGAGTCGGGCGATTGCGGGGGCGTTGGCG
GGTAGGGGTGGGATGGTGGCGGTGTCGTTGCCGGTGGAGGGTGTGCGGGGGTTGTTGTCG
GGGGGGTTGTCGGTGGCGGTGGTGAACAGTCCTGGTGGTGTGGTGGTGGCGGGTCCGGTG
GAGGAGTTGGATGCGTTGTTGGTGGTGTGTGAGGAGCGGGGGGTGCGGGCGCGTCGGGTG
CCGGTGGATTATGCGTCGCATTCGGTGTTTGTGGAGTTGATCGAGGATCGGGTGTTGGCG
GATTTGGCGGGGTTGGCGCCGGTGTCGTCTGGGGTGCCGATGTATTCGTCGGTGTCGGGT
GAGCGGGTGGATACGGCGGGTTTGGATGGGGGGTATTGGTATCGGAATTTGCGGCAGACG
GTGGAGTTCGAGCGGGCGACGCGGGCGTTGGCGGCGGATGGTTTCTCGGTGTTTGTTGAG
GTGAGTCCGCATCCGGTGTTGACGGTGGCGGTGCAGGACACGTTGGGTGAGGGTGTGGTG
GCGGCGGGGACGTTGCGTCGTCATGAGGGTGGGTTGGACCGGTTCCTGTTGTCGGCCGCG
GAGCTGTTCGTCCGTGGGGTGCCGGTCGCCTGGGACGGGTTGTTCGCCGGGCGGCGGACG
CGTCGGGTGGATCTTCCGACGTACGCCTTCCAGCGCCGCCGCTACTGGCCGCAGCCTTCG
TTGGTGGCGGGGGACGTGGCGGCCGCGGGTCTGGTGTCGGCGGAGCATCCGTTGCTGGGT
GCGGTGGTGTCGGTGCCGGAGTCGGGGACGGTGGTGTTGACGTCGCGGTTGTCGTTGCGG
GCGCAGCCGTGGTTGGGGGACCACGCGGTGCACGGGACGGTGATCTTCCCGGGGACGGGG
TTCGTGGAGCTGGCGATCCGCGGTGCGGACGCCGCCGGCGCGGGCCGGGTGCGCGAGCTG
ATCGTGGAGTCGCCACTGGTGGTGCCGGAGCGGGACAGCGTCCAGGTGCAGGTGGTGGTC
GATGCCGAGGACCATACCGTCGCCGTCTACGCCCGTGCGGGTGAGGACGAGCCGTGGACC
CGGCACGCCAGCGGCTCGACCGGCACCGAGGCCCTCGCCGTCGAGGCGGGGGAGTTCGCC
GGGGAGTGGCCGCCGGCGGGCAGCACGCCGGTCGACCTGGAGGACTTCTACCAGCGCAGC
GCCGACAGCGGGTTCGGCTACGGCCCGGTCTTCCAGGGCCTGACCCGGGCATGGCGGCAC
AACGGCGACATCCTGGCCGACATTGCCCTCCCGCAGGACGAGCGGACCGGCGCGGGCGCG
TTCGGCATCCACCCCGCGCTGCTGGACGCCGCCCTGCACCCCTCCACGTTCGCCGACCTC
GAACCCACCGAGCTCGGCCGGCTGCCCTTCGCCTTCAACGACGTCACCCTGCACGCCACC
GGGGCCACCCGGGTCCGGGCGCGGATCACGCCCGCGGGACCCGACGCCGTCGCCCTGGAA
CTCGCCGACGAGGCCGGACAACCGGTGCTGTCGATCGGGTCCCTCGTCCTCCGGCCGCTC
ACGGCGCAGACGCTGGCCGGCGAGGCACGGCCCGGCGCGATGCTGGCCCTCGACTGGGTG
GAGGTACCGGCGCCCGAGGCCGGCGTCCAGGATGGCGGGTTCACCGTCGTCCGAGGCCCC
GCGGGCGCCACGCCTGCCGCGGTGGCCACGGACGACGCCGATTCCGACGCCGATTCCGAC
GCCGGCACTGACGCCGAACCGTCCGACCTCGTGGTCCTGGAGGTCGCCCCGGAGGGCGAC
CAGGTGGTGGAGGCCGTCCACGCGACGGCGAACTGGGTGCTCGGCCGGCTCCAGGCGTTC
ACCGGCACGCGCATGGCCGTCGTGACCCGGGGCGCGGTCGCCGCCGGCCCGGGCGAGACC
GTCACCGACCTGGCCGCGGCCTCGGTGTGGGGCCTGGTCCGCTCCGCGCAGACCGAGGAC
CCGGGCCGCTTCGTGCTGCTCGACATCGCGCCGGACGCCGCGCCGGACGCCGTTCTCGAC
GCCGCTCTGGTGGCCCGCGCGTTCGCGGCGGACGAGCCGCAACTCGCCCTGCGCGGCGAG
GTGTTCCGCAGTCCGCGCTTCACCCGGGTGCCCGGCTCCGAGGAGGAGCCCGCCCCGGTC
GCCCTCGACGGCACCGTCCTGGTCACCGGCGGCACCGGTGGCCTGGGCCGCGAGGTGGCC
CGGCACCTGGTGGCCCGCCACGGTGCGCGCGACCTGCTGCTGCTCAGCCGTCGGGGAGGC
GACGCCGAGGGCGCCGCCGAACTCGTCGAGGAGTTGGCCGCCCAGGGCGCCCGGGCCACC
GTCGCCGCGTGCGACGTCGCCGACCGCGAGGCCCTGGCGGCGGCGCTCGCCGGCACGAAG
CTGGCCGGTGTGGTGCACACCGCGGGCATCCTGGACGACGGGACCGTCGCGTCGCTGACC
GCGGACCAGATGGACCGGGTCATGCGGCCGAAGGTCGACGCCGCCTGGCACCTGCACGAG
CTGACCCGGGACGCCGACCTGCGCGTCTTCGCGGTGTTCTCGTCGTTCTCCGGGCAGATC
GGCAGCCCGGGGCAGGGCAACTACGCCGCGTCCAACATGTTCCTGGACGCGCTGATGGAA
CAGCGCCGCCAGGACGGCCTGCCCGGCGTCTCGATGGCGTGGGCCGCCTGGACGCAGGAG
GTGGGCCTGACCGGAACCCTGTCCGAGGTGGACATGCGCCGCATCGCGCGCTCCGGGGTG
CCGCCGCTCACCGTGGAACAGGGCCTGTCGCTCTTCGACCAGGCGCTGGCGGCCGACCGC
CCCGTCCTCGCGCTGGCCCGGCTCGACCTGCCACGCCTGCGTGCGCAGGGCGAACTCCCG
GCGGTCCTGCGCGGCCTGGTCCCCGGGCCCGTACGCCGTGCGGTGGCCGCGCAGGAGGTG
CGCGGCGACGGCTTCGCGCAGCGCATGGCCGCGCTGCCGGCCCAGGAGCGCGCCGCCCAC
CTGCTGACCCTGGTGCGCGACCACGTCGCCTCGGTGCTCGGCTACCCGTCCGGCGCCGAC
ATCGACGAGGCCAAGCCCTTCCGGGAGATCGGCTTCGACTCGCTCACGGCCGTCGAACTG
CGCAACCGGTTGCAGGCCGTCACCGGCCTGGGCCTGCCCTCGACGCTCGTCTTCGACTAC
CCGACCGCCGTACGCCTCGCGGAGTACGTGGGCGAGCGCCTCGGCGGGGTCTCCGCCGTC
CCGGTCGACGCGCTGCCGGTGCTGCGGTCGGTCGACGACGATCCACTGGTCATCGTGGGC
ATGTCCTGCCGCTTCCCGGGCGGGGTCTGGAACCCGGACGGCATGTGGGACCTCCTGGCG
CAGGGGCGGGACGCCATGACGCGCTTCCCCGGCGACCGCGGCTGGGACACCGGCCTCCTG
ACGGAGCTGGCCCACGCGGGCGGCTTCGTCGACGGCGCCATGGACTTCGACGCGGGCTTC
TTCGCGATGTCGCCGCGCGAGGCGCTGGCGACGGACCCGCAGCACCGCCTGCTGCTCGAA
GGCTCGTGGGAGGCGCTGGAGCACGCCGGCATCGACCCCGTCTCGCTCGCGGGCTCGGCG
ACCGGTGTGTTCGTCGGCAGCTACCAGTCGGGCTACTCCGAGGTCGCCGGCGAGGCGATG
ACGGACTCCGACGCGAACGCGCAACTGCTCACCGGCGGTGCGCAGAGCGTGCTGTCCGGC
CGGGTGGCGTACGCGCTGGGCCTGGTCGGACCGGCGCTGACGGTCGACACCGCCTGCTCC
TCCTCCCTGGTGGCGCTGCACCTGGCCGGTCAGGCGCTGCGGGGCGGCGAGTGCTCGCTC
GCCCTGGTGGCGGGCGTGACGGTCAACGCGCTTCCGCACACCTTCGTCGGGTTCTCGCAG
CAGGGCGGTCTGTCGGCCGACGGCCGGTGCAAGGCGTTCGCCGAGGCCGCCGACGGGACG
GGCTTCAGCGAGGGCATGGGGGTCGTGGTCGTCGAGCGGCTGTCCGACGCGGAGCGCAAC
GGGCACCGGGTGCTGGCGGTCGTACGCTCCAGCGCGGTGAACCAGGACGGTGCGTCGAAC
GGCCTGACGGCGCCGAACGGTCCGTCGCAGCAGCGGGTGATCCGCCAGGCGCTGGCGGCC
GCGGGTCTCGACGCGGCGGACGTGGACGCGGTGGAGGCGCACGGCACGGGCACCACGCTG
GGCGACCCGATCGAGGCGCAGGCGGTGCTGGCGACGTACGGCCAGGACCGTCCGGAGGAC
CGGCCGTTGTGGCTGGGCGCGGTGAAGTCGAACATCGGCCACACGCAGGCGGCCGCGGGC
GTGGCCGGCGTGATCAAGATGGTGCTGGCGATGCGGCACGGGCTGCTGCCGCAGACGCTG
CACGTCGACGAGCCGAGCACGCACGTGGACTGGGAGCAGGGCCGGGTGCGGCTGCTGACC
GAGGCCACGCCGTGGCCGGACAGCGGTCGTCCGCGCCGCGCGGGTGTGTCGTCGTTCGGG
ATCTCGGGGACGAACGCGCACGTGATCCTGGAAGCCGCCCCCGGCACGGAGGCCGCCACC
GGCGCGCAGACGGGCATGGCAACCGGTACCGGGACGACCGGTACCGGGACGACCGGCACC
GGGGCGACCGGCGTGGAGGCGGCGGCGTCCGCATCCGGAGCCGACACGGTCCCCGAGCAC
GCCTCCGAGACGGTGTGGGTGGTGTCGGCCCGTACGGAGGCGGCGTTGCGGGCGCAGGCG
GAGCGGCTGTTGTCGGCGACCGAGGGGCTGGACCCGGCGGACGTGGGTGCGGCGTTGTTG
TCGCGGTCGGCGTTCGACCATCGTGCGGTGGTGGTGGGTGCGGATCGCTCGGAACTCGTC
TCCGGGTTGCGGGCGTTGGCGGCCGGTGAGGCGGCGGGGAACGCGGTGGAGGGTGTGGCG
CGGAGCGGCCGTCGGGTGGCGGTGTTGTTCACCGGTCAGGGTGCGCAGCGGCTGGGGATG
GGCCGCCGGCTGCACGGGGAGTCGCCGGTGTTCGCGGCGGCTTTCGACGAGGTGGTGGCG
GAGTTGGACCGGCACCTCGACGTTCCGTTGCGGGAGGTGGTGTGGGGTGAGGACGCCGAG
GCGTTGAACTCCACTGGTTGGGCTCAGCCGGCGTTGTTCGCGGTCGAGGTGGCGTTGTTC
CGGCTGTTGGAGTCCTTCAGCATCACACCGGACTACCTGTTGGGGCACTCCATCGGTGAG
GTGGCTGCGGCTTACGTCGCCGGGGTCTTCGAACTGGCGGATGCGTGCCGGTTGGTGGCG
GCGCGGGCGCGTTTGATGCAGGCGCTTCCGGCGGGTGGGGCGATGGTGGCCGTCGCCGCT
TCCGAGGACGACGTGCTGCCGCTTTTGTCGGACGGCGTCTCTGTCGCGGCGGTGAACGCG
CCGGGTTCGGTGGTGGTCTCCGGTGAGGAGTCCGCGGTGCTCGCGGTCGGTGAGCACTTC
AAGGCGCTGGGGGTGAAGACGACCCGGCTGCGCGTCTCGCACGCCTTCCACTCGGTCCTG
ATGGAGCCGATGCTGGACGACTTCCTGGCCGCGATCGCGGATGTGTCGTTCTCCGAGCCG
CAGATCCCGGTGGTGTCGAACCTGACGGGCGAGCCGGCGGACATGACGTCGCCGAAGTAC
TGGGCGCAGCAGGTGCGTTCGGCGGTCCGCTTCGCGGACGGACTGGCATGGCTGACCGCG
CACGGTGTGGACGCCTTCGTCGAGGCGGGACCGGACGCGGTGCTGGCCGGACTGGTGGAC
CTCAACGGGGCCGCCGGCGCGACCGCCGTGGCACTGCAACGCGGCGACCGCACCGGCGGC
CAGGTCGCCCACCACGCGGTGGGGCGGCTGTACGTCCACGGGGTGCCGGTGCGGTGGGAC
GTCCTCTTCACGGGCCGCGAGCCCCGCTGGGTGGACCTGCCGACGTACGCGTTCCAGCGC
CGCCGCTACTGGCCGCAGGCGTCCCTCGCGGGCGGCGACGTGACCGCCGCGGGTCTGGCG
TCGGCCGAACACCCGCTGCTGGGCGCGGTGGTGTCGGTTCCTGAGTCGGACACGGTCGTG
CTGACCTCGCTGCTGTCGCTGCGCACGCAGCCGTGGCTGGCCGACCACGCCGTCCAGGGC
ACGGTCATCCTCCCCGGCACCGGCTTCGTGGAGCTGGCGATCCGCGGTGCGGACGCCGTG
GGCGCGGGCGGGCTGCGGGAGTTGATCGTGGAGGCGCCGCTGGTCGTCCCCGCCTCCGAC
AGCGTCCAGGTCCAGGTCGTCGTGGACGGCGGGACCGCCGTCGTCTACGCGCGGCCCGCC
GGTGACGAGCCGTGGACGCGGCATGCGACCGCGGTGCTCGGCGAGGCCCTGCCCGCGGGC
GCGGGTGCGGGTGCGGGTGGGTGGCAGTGGCCGCCGGCCGACGTCTCGTCCGTCGACGTG
TCCGACTTCTACGACCGGATGGCCGAGGGCGGTTTCGTCTACGGTCCGGCGTTCCGGGGT
CTGCGGCGGGTGTGGCAGGCGGAGGGTGAGGTCTTCGCGGAGGTGGCGGTCGGGGAGGAG
GAGACCGATCGGGCGCGGAGGTTCGGTGTGCATCCGGCGTTGCTGGACGCGGCGCTCCAG
GCGAGTGCGTTTGTGGGGCTGGATCCGGCGCCGGCGGGTCGGTTGCCGTTCAGCTTCGGT
GAGGTGACGCTGCACGCGGGTGGTGCGGTGGCGTCGCGGGTGCGGGTGGCGCGTACGGGG
GCGGACAGCGTCCGTGTGGAGTTGGCGGACGGCAACGGTGACCCGGTGCTGACGATCGGT
TCGCTGGTGATGCGGCCGGTGGCGGCCGGGGGCGTGGCCGGTGGGGTGCGGTCCGGTGCG
GTGCTGGCGGTCGACTGGTCGTCGGTGGTCGCCTTGGACGAGGCGGCCGGGCCCGGGGCG
CCCCTTCGGGTGGTGGGCGCCCCGGAGGACCTCGTCGTGGAGGATCTGGTTCCGGGTGAG
GTCGTGGTGTTGGAGGCGGTCGGTACGGCGGGTGAGGTGGTGGGTTCGGCTCATGGGTTG
GCTGGTTGGGTGTTGGCGCAGGTGCAGGGGTGGCTTGGGGATGAGCGGTGTGCGGAGGGT
CGGTTGGTGGTGGTGACGCGGGGTGCGGTGTCGGCGGTGCCGGGGGAGGTGTTGGCGGAT
GTGGCGGCGTCGGTGGTGTGGGGTCTGGTGCGTTCGGCGCAGGCGGAGAATCCGGGGCGG
ATCGTCCTGCTCGACCTCGACCAGCGGGCCTCCGCCGTGGACGCGGGCCTGGTCGCGGGG
GTGGTGGCCGCTGGTGAGCCGCAAGCGGTCGTGCGCGACGGTGTGGTGCGGGCCGCGCGC
TTGGTCCGTGTCGCGGCTGCGGCTGACGGGGACGCGGGGGGAGAGGTGGGCTTTGGTGCG
GGCACGGTGCTGGTGACGGGTGGTACGGGTGGGCTGGGCCGTGAGGTGGCGCGTCACCTG
GTGGCGGTGCACGGTGTGCGGGATCTGCTGCTGCTGAACCGTAGTGGTGGCGGCGCCGAA
CTCGTGGCGGAGCTGGCGGAGTTGGGTGCGCGGGCGCGTGTGGTCGCGTGTGACGTCGCG
GATCGTGTGGCGCTGGCGGAGGTGCTTGCGGGTGTGCGTCTGACGGGTGTGGTGCACACG
GCTGGTGTGGTGGATGACGGTCTGGTGTCGTCGTTGACCGTCGAGCGGTTGGATCGGGTG
TTGGCGCCGAAGGTGGATGCGGCGTGGTATTTGCACGAGTTGACGGCGGGGATGGATCTG
TCGGCGTTCGTGGTGTTCTCGTCGTTGGCCGGTGTGGTGGGTAGTCCGGGGCAGGGGAAC
TACGCGGCGGGCAATGTGTTCTTGGACGCGTTGATGCAGTATCGGCGGCTGGAGGGGTTG
CCGGCGGTGTCGATGGCCTGGGGTCCGTGGGCCCAAGGTGCGGGTCTGACGGGTGAGTTG
TCGGATGTCGACATGCGGCGGATCGCCGCGTCGGGAACGCCGCCGTTCACGGTGGAGCAG
GGTCTGGCGGTGTTCGACGCGGCTCTGGGCAGTCCGGAGGCGGCCGTCGCCCTGACCCGG
CTCGACCTCGCGGCACTGCGGACCCGCGACGAACTGCCCCCGCTGTGGCGCACCCTGGTC
GGGCAACCGGCCCGGCGCGCCGCCGGCGACCACCGCGCCGCCCCCGACGACCTCGCGCAC
CGCCTCGCGGGCCGTTCCCTCGCCGACCGCGAGGAGGACCTGCTGGCCCTGGTCGCCGAC
CACGTGGCGGCGGTGCTCGGGTACGCCTCCCGCGAGCAGATCGACACCGCCCAGGCGTTC
CGGGACATGGGCTTCGACTCGCTCAGCGCCATCGAGCTGCGGAACCGGCTCCAGGCCGCG
ACGGGACTCACCGTCCCGGCCACGCTGGTCTTCGACTACCCGAACGCGCGGCGCCTCGCG
GCCTACCTCGCCGAGCAGTTCGGCGACGCCCCGCGCGGGTCGGCGGTGGCCCTGCCACCG
CTCGTCTCCGTGGACGACGACGCGCTCGTCATCGTCGGCATGGCCTGCCGCTTCCCGGGC
GGGGTCCGGGACATCGACGGCTTCTGGCAGCTCGTCGCCAACGGCGGCGACGGCATGTCC
CCCTTCCCCGCCGACCGCGGCTGGGACCTGGAGGCGCTGTACGACCCGGCGGGCGACCGC
TCGGGCACCTCCGCCACCCGCGAGGGCGGCTTCCTGGACGACGCGCTCGACTTCGACGCC
GGCTTCTTCGGCATCTCGCCCCGCGAGGCGCTCGTCACCGACCCGCAGCAGCGGCTGCTG
CTGGAGACGTCGTGGGAGGCGCTGGAGCACGCCGGGATCGCCCCCGAGCGGCTGGCCGGC
AGCAGCACCGGCGTCTTCGTCGGCAGCTACCAGTCCGGCTACAGCGAGGTCATCGGCGAC
GCCCTCGACGAGGCCGAGCCGCAGATGCTCACCGGCAACGCCCAGAGCGTGCTGTCCGGC
CGGGTGGCGTACACGCTGGGTCTCGAAGGTCCCGCGGTGACGGTGGACACGGCCTGCTCG
TCGTCCCTGGTGGCGCTGCACTGGGCGGGCCAGGCGCTGCGCGCGGGGGAGTGCTCCCTC
GCCCTGGTCGGCGGCGTGACCATGATGGCCACCCCGAGCACCTTCGTCAGCTTCTCCCAG
CAGGGCGGCGTCGCGTCGGACGGACGCTGCAAGGCGTTCGCGGACGGTGCGGACGGCACC
GGCTGGTCCGAGGGCGTCGGTGTGCTGGTGGTGGAGCGGTTGTCGGACGCGGAGCGCAAC
GGGCACCGGGTGCTGGCGGTCGTACGCGCCAGCGCGGTGAACCAGGACGGCGCGTCGAAC
GGCCTGACGGCGCCGAACGGCCCCTCCCAACAGCGGCTGATCCGGCAGGCGTTGGCGGCG
GCCGGGCTCAACTCCGGTGACGTGGACGCCGTGGAGGCGCACGGCACGGGCACGTCCCTG
GGCGACCCGATCGAGGCGCAGGCGGTGCTGGCGACCTACGGCCAGGACCGGCCGGAGGAC
CGGCCGCTGTGGCTGGGCGCGGTGAAGTCGAACATCGGTCATACGCAGGCGGCGGCGGGT
GTCGCGGGCGTGATCAAGATGGTGCTGGCGATGCGGCACGGGGTGCTGCCGCAGACGTTG
CACGTGGACGAGCCGAGCACGCACGTGGACTGGAGCCAGGGTCAGGTGCGGCTGCTGACC
GAGGCCACGCCGTGGCCGGAGAACGGCCGCCCGCGCCGGGCCGGTGTGTCGTCCTTCGGT
ATCTCCGGGACGAACGCGCACGTGATCCTGGAGGCTCCCGAGGTTGAGGCCGAGGCCGAG
GCCGAGGTCGGAGTCGTTCCGGGCGTTCAGGACGAGCCGGCCGCGGGTGCGGGTGGGGCT
GCTCCGGTGGCGTGGGTGGTGTCGGGGCGTTCGGCGGCCGCGGTGCGGGGTCAGGCGGGT
CGTCTGCTGGCGGCTGTGGAGTCGTCCGGGTCGGCGGGTTCGGTGGAGCCGGTGGATGTG
GGTGCGGCGTTGTTGTCGCGTTCGCTGTTCGACCACCGGGCGGTGGTGGTGGGTTCGGAT
CGTGAGCAACTGGTGTCGGGTGTGCGGGCGTTGGCGGCGGGTGAGCCGGCCGGGAACCTG
GTGGGCGGCGCTGCCGGCGGTGGTCAGGAGCGTCGGGTGGTGTTCGTCTTCCCGGGTCAG
GGTGCGCAGTGGGTGGGTATGGCGGCGGGTCTGCTGAATTCCTCGTCGGTGTTTCGGGAG
TCGATGGAGTTGTGTGGGGAGGCGTTGAGGCCTTTTGTGGAGTGGGATTTGTTGGGGGTG
TTGGGTGAGGGGGATGAGGTGGTGTTGGGGCGGGTTGATGTGGTGCAGCCGGTGTTGTGG
GCGGTGATGGTGTCGTTGGCTGCGGTGTGGCGTTCGTGGGGTGTGGTGCCGGCTGCGGTG
GTGGGGCATTCGCAGGGGGAGATTGCGGCGGCGTGTGTGGCGGGGGGTTTGTCGTTGGGT
GATGGTGCGCGGGTGGTGGCGTTGCGGAGTCGGGCGATTGCGGGGGCGTTGGCGGGTAGG
GGTGGGATGGTGGCGGTGTCGTTGCCGGTGGAGGGTGTGCGGGGGTTGTTGTCGGGGGGT
GTGTCGGTGGCGGTGGTGAACAGTCCTGGTGGTGTGGTGGTGGCGGGTCCGGTGGAGGAG
TTGGATGCGTTGTTGGTGGTGTGTGAGGAGCGGGGGGTGCGGGCGCGTCGGGTGCCGGTG
GATTATGCGTCGCATTCGGTGTTTGTGGAGTTGATCGAGGATCGGGTTCTTGATGATCTG
GCGGGGTTGGCGCCGGTGTCGTCTGGGGTGCCGATGTATTCGTCGGTGTCGGGTGAGCGG
GTGGATACGGCGGGTTTGGATGGGGGGTATTGGTATCGGAATTTGCGGCAGACGGTGGAG
TTCGAGCGGGCGACGCGGGCGTTGGCGGCGGATGGTTTCTCGGTGTTTGTTGAGGTGAGT
CCGCATCCGGTGTTGACGGTGGCGGTGCAGGACACGTTGGGTGAGGGTGTGGTGGCGGCG
GGGACGTTGCGTCGTCATGAGGGTGGGTTGGACCGGTTCCTGTTGTCGGCCGCGGAGCTG
TTCGTGCACGGCGTTCCCGTGACGTGGAACGGTCTGTTCGCGGACCGGAAGCCGCGTCGG
GTGGATCTTCCGACGTACGCCTTCCAGCGCCGCCGCTACTGGCCGCAGCAGTCCTCGGCG
GTCGGCGACGCCGCCCTGCGCGACCCGGTGGACGCGGAGTTCTGGGCGTCGATGCAGAGC
ACCGACGTCTCCGACCTCGCGCGCTCCCTCGGCGTGGACAGCACCACGCTGTCGGACGTG
GTGCCCGCCATGCTGCGGTGGCGCGACCAGCGGCAGTCCGAGTCGCAGGCGGACGGCTGG
CGCTACCGCGAGACGTGGGCACCCGTGTCCGCCACCGGCCGCCCCCTCGACCCGTCCGCC
GCGCGCTGGGCGGTGATCGTGCCCGAGGGACACGCCGACGACCCGTGGTCGGCGGCCGTG
GCCGAGGCCGTCGGCGGCGAGCTGATCGAGGACGACGGCTCCGCCCCGGAGCTGAGCCCC
GCCTGCCCCGGCGTGCTGTCGCTGCTGTCGGCCCGGGACGACGTCGAGGGACTGCTGTCC
ACCGTCCGGCTGGTCCAGCACCTGCGGGCCCCGGTGTGGGCGGTCACGCGCGGCGCCGTC
GCCGTACGCCCCGAGGAGCGTGTCAGCGGGGTCTGGCAGGGCGCCACGTGGGGCATCGGG
CGGGTGGCCGCCCTGGAGCTGTCCGAGCGGTGGGCCGGTCTGCTGGACCTGCCCGACGTG
ATCGACGACGCGGTGCGGGAGCGGCTGCGCACCGTGGTCGCGGGCGGGCACGGAGAGGAC
CAGGTGGCCGTCCGGTCGTCCGGGCTGTTCGCCCGGCGCCTGGTCCACGCCGCGGCGCCC
ACGCTGCCCGCTTCCTGGCGGACCAGCGGCACGGCGATCGTGACCGGCGGTACCGGCGGG
GTCGGCGCGCACGTGGCGCGCTGGCTGGTCCGGGTCGGCGCCGAGCACGTGGTGCTCGTC
AGCCGGCGCGGCCCGGCCGCGGACGGCGCCCGGGAGCTGAGCGCCGAACTCGAAGCGGCG
GGCGCCCGGGTGAGCGTGGTCGCGGGTGACGTGGGCGACCGCGACACCCTCGCGGAGCTG
ATCGCCTCCGTCCCGGCGGAACTGCCGCTGCGCAGCGTCCTGCACGCGGCCGGCGTGGTG
GACGAGGCCGGGGCCGTGGAGACCCTCACCGCGGAGGCGCTCCAGGCGCAGCTACGGGTC
AAGGTCGCCGGCGGGCTGCTGCTCGACGAACTCACCCAGGACCTGGAGCTGGACGCGTTC
GTCCTCTTCTCCTCGGGGGCGGCTGCCTGGGGCAGCGCGGGCCAGGGCAGCTACGCCGCG
GCGAACGCCTGCCTCGACGCCCTGGCCGGACACCGCCGGGCCCGGGGCCTGACGGCGCTG
TCCGTGGCGTGGGGCGCCTGGGACGCGCCGGGCATGATGGCGGCGGACGCCGACTACGCC
CAGTACCTGGAGCGGCTCGGCGTCCACCCGATGCAGCCGGAGGCGGCGGTCGCCGCCCTG
CACCGGGCGCTCAGCGACGGCGACACCAACGTCACGGTCACGAACATGGACTGGTCGCGC
TTCGTTCCGGCGTTCGGCATGGCCCGTCCCAGCCGCCTGTTCTCGCTGCTGCCGGAGGCG
GCTGCCACCGCCGACCCGGAGGAGCAGGAGGAGGGCGTCGACCACCTGCGGTCCATGACC
GCGCGGGAGCGCCGCGACCACCTGCTCGCGGCGGCCCGCGACCACGCGGCCGCCGTGCTC
GGCTACGACTCGGGCGACCAGGTCGACGCCGCCCAGGCGTTCAAGGAACTGGGCTTCGAC
TCGGTCACCGCGGTGGAGTTCCGCAACCGCCTCCAGACCGTCACCGGGCTGAGCCTGCCG
ACCACCCTCGTCTTCGACTACCCCAACGCCGGGCGGATCGCGGACTACCTGGCCGAGCGT
TTCGGCGACACGTCGGCGCAGGCCGAGGACGCGCTGCCGGCGCTGGTGGCCGGGAGCACC
GACGACCCGATGGTGATCGTGGGCATGGCCTGCCGCTTCCCCGGCGGGGTGAACAACCCG
GCCGACCTGTGGCGGGTCGTCACGGACGGCGTCGACGTGATGTCCGGCTTCCCGGACGAC
CGCGGCTGGGACCTCGACGCGCTGTACGACCCGAACGGCGAGCGCGCCGGCTCCTCGGTC
ACCCGGGAGGGCGGCTTCCTGGAGGACGCGGGCGGCTTCGACGCGGGCTTCTTCGGCATC
TCCCCGCGTGAGGCGATGGCGACGGACCCGCAGCAGCGGCTGGTGCTGGAGGCGTCCTGG
GAGGCGTTGGAGCACGCGGGCATCGACCCGGCCGCGCTGGCCGGGACCGCCACTGGAGTC
TTCATCGGCGCCGCGCCGTCCGGTTACAGCGAGGTCGCCGGCGCGACCCCGGAGGCCCAG
GGGCACCTGCTGACCGGCGGTCTGCTGAGCGTGCTGTCGGGCCGGGTGGCCTACACCCTC
GGCCTCCAGGGCCCCGCGGTCAGCGTGGACACGGCCTGCTCGTCGTCCCTGGTGGCGCTG
CACTGGGCCGGGCAGGCGCTGAACTCGGGGGAGTGCTCCCTCGCGCTGGTCGGCGGGGTG
GCGGTCATGGCCACGCCCGGCGGGTTCGTGGAGTTCAGCCGCCAGGGCGGCCTCGCCGCC
AACGGCCGCGTGAAGGCGTTCGCGGAGGCGGCGGACGGGACCGCGTGGTCCGAGGGCGTC
GGCGTCGTGGTCGTCGAGCGGCTGTCGGAAGCCCGGCGCAACGGGCACCGGGTGCTCGCG
GTGGTGCGCTCCAGCGCGGTGAACCAGGACGGTGCGTCGAACGGCCTGACGGCGCCGAAC
GGCCCGTCGCAGCAGCGGGTGATCCGCCAGGCGCTGGCGGCGGCCTCCCTGGCACCGTCC
GATGTGGACGTGGTGGAGGCGCACGGCACGGGCACGACGCTGGGCGACCCGATCGAGGCG
CAGGCGCTGCTGGCGACCTACGGCCAGGGGCGGCCGGAGGAACGGCCCCTGCTGCTGGGG
TCGTTGAAGTCGAACATCGGTCACACGCAGGCGGCCGCGGGTGTGGCCGGCGTGATCAAG
ATGGTGCTCGCGATGCAGAACGGGGTGGTGCCCCGCACGCTGCACGTGGACGCGCCGTCC
TCGCAGGTCGACTGGTCCGCGGGCAGCGTCGAACTGGTCACCGGTGAGATGGCCTGGCCG
GAGAGCGGTCGTCCGCGCCGGGCGGGTGTGTCGTCCTTCGGTGTCTCGGGGACGAACGCG
CACGTGATCCTGGAGGCGGCGCCTGGGGTGGAGGTCGAGGCCGAGGTCGAGGCGCGGGTC
GAGGTCGCGGGAGAGGCTGGGGCCGAGTCCGAGTCCGAGTCCGAGTCCGGGTCGGGGTCG
GTGTGGGTGGTGTCGGGTCGTTCGGAGGGGGCGTTGCGGGCGCAGGCGGAGCGGTTGTTG
TCGGTGGCCGAGGGGCTGGATCCGGTGGATGTGGGTGGGGCGTTGTTGTCGCGGTCGGTG
TTCGAGCACCGTGCGGTGGTGGTGGGCAGTGGGCGTGAGGAACTGACGGCGGGGTTGCGG
GCGTTGGCGGCCGGTGAGGCGGCGGGCAACGCGGTGGAGGGTGTGGCGCGGAGTGGTCGT
CGGGTGGCGGTGTTGTTCGCGGGTCAGGGTGCGCAGCGGCTGGGGATGGGGCGCCGGCTG
CACGGGGAGTCGCCGGTGTTCGCGGCGGCTTTCGACGAGGTGGTGGCGGAGTTGGACCGG
CACCTCGACGTTCCGCTGCGGGGGGTGGTGTGGGGTGGGGACGCGGATGCGTTGAATTCG
ACGGGTTGGGCGCAGCCGGCGTTGTTCGCGGTCGAGGTGGCGTTGTTCCGGCTGTTGGAG
TCGTTCGGTATCACACCGGATTACCTGCTGGGGCACTCCATTGGTGAGGTGGCGGCCGCG
CATGTGGCCGGGGTGTTCGATCTGGCGGATGCGTGCCGGTTGGTGGGGGCGCGGGCGCGT
TTGATGCAGGCGCTTCCGGTGGGTGGGGCGATGGTGGCGGTTGCCGCGCCGGAGGAGGAG
GTGCTGCCGCATCTGTCCGACGGGGTCTCTGTCGCGGCGGTGAACGCGCCGGGTTCGGTG
GTGGTCTCCGGTGAGGAGTCCGCTGTGCTCGCGGTCGGTGAGCATTTCAAGGCGTTGGGG
GTGAAGACGACCCGGCTGCGGGTGTCGCACGCCTTCCATTCGGCGTTGATGGAGCCGATG
GTGGACGACTTCCTGGCGGCGATCGCGGATGTGTCGTTCTCGGAGCCGCGGATTGCGGTG
GTGTCGAATCTGACGGGTGAGCCGGCGGATATGACGTCGCCGAAGTACTGGGCGCAGCAG
GTGCGTTCGGGGGTGCGGTTCGCGGACGGTGTGGCGTGGTTGGCCGCGCAGGGTGTGGAC
GTGTTCGTGGATGCGGGTCCTGATGGTGTGGTGGCGGGTCTGGCGCAGGCGAACGCGTCG
GATGCGGTGGCGGTGGCGTTGATGCGCAAGGACCGTGAGGGTCTGGCCATGGCGTTGCTG
GCCGCGGGTGACCTGTTCGTGCACGGGGTGCCGGTGGAGTGGGTCGGACTGACCGGCGGG
CGGGGGTCGGAGTGGGTCGAGCTGCCGACGTACGCCTTCCAGCGCCGCCGCTACTGGGCG
CAACCGAAGCCCGTCGGTGATGTGGCGGCTGCGGGTCTGGTGTCGGCGGAGCATCCGTTG
CTGGGTGCGGTGGTGTCGGTGCCGGAGTCGGGGACGGTGGTGTTGACGTCGCGGTTGTCG
TTGCGGGCGCAGCCGTGGTTGGGGGATCACGCGGTGCACGGGACGGTGGTCTTCCCGGGG
GCGGGGTTCGTGGAGTTGGCGATCCGCGGTGCGGACGCGGTGGGTGCGGGTGGTCTGCGG
GAGTTGGTCGTGGAGGCGCCGTTGGTGGTTCCCGCGGTCGGCAGTGTTCAGGTGCAGGTG
GTGGTCGGAGACGGTGGGTCCTTGACGGTGTACGCGCGTGCCGCGGACGAGGAGCCGTGG
ACACGGCATGCGACCGCGGTGCTCGGCGATGCCCTGCCCGCGGACGTGGTTGCGGGTGGG
TGGCAGTGGCCGCCGGCCGACGCCTCGTCCGTCGACGTCTCGGACTTCTACGAGCTGACG
GCCGACCACGGTTTCGTCTACGGTCCGGCGTTCCGGGGTCTGCGCCAGGTGTGGCAGGCG
GAGGGTGAGGTCTTTGCCGAGGTGGCGGTCGGGGAGGAGGAGACCGATCGGGCGCGGAGG
TTCGGTGTGCATCCGGCGTTGCTGGACGCGGCGCTCCAGGCGAGTGCGTTCGTGGGGCTG
GATCCGGCGCCGGCGGGTCGGTTGCCGTTCAGCTTCGGTGAGGTGACGCTGCACGCGGGT
GGTGCGGTGGCGTCGCGGGTGCGGGTGGCGCGTACGGGGCCGGACAGCCTGCGCGTCGAA
CTGGCCGACGGCAACGGTGATCCGGTGTTGACGATCGGTTCGCTGGTGATGCGGCCGGTG
GCGGCCGGGGGCGTGGTCGGCGGCGCGCAGGCGGGTGCGGTGCTGGCGGTCGACTGGTCA
TCGGTGGTCACGCTGCCGGAGGTGGACGCGGGCGCGGACACGGGCACGGGCACGGACGCG
GGCATGTCTGTGGGCGTGGATGGGGGTGTGGCGGTGTTCCGGGCTCCGGAGGATGTGGTT
CCGGGTGAGGTCGTGGTGTTGGAGGCGGTCGGTACGGCGGGTGAGGTGGTGGGTTCGGCT
CATGGGTTGGCTGGTTGGGTGTTGGCGCAGGTGCAGGGGTGGCTTGGGGATGAGCGGTGT
GCGGAGGGTCGGTTGGTGGTGGTGACGCGGGGTGCGGTGTCGGCGGTGCCGGGGGAGGTG
TTGGCGGATGTGGCGGCGTCGGTGGTGTGGGGTCTGGTGCGTTCGGCTCAGGCGGAGAAT
CCGGGGCGGATCACCTTGCTGGACCTTGGTGCCGGTGAGGGGGTCGGGTCCGTGGACCGT
GCTGTGGTGGTCGGGGCGGTGGCTTCCGGTGAGCCGCAGCTCGTGGTCCGCGATGGTGTG
GTGCGGGCCGCGCGCTTGGTCCGTGTCGCGGCTGCGGCTGACGGGGACGCGGCGGGGTCG
GTGGGCTTTGGTGCGGGCACGGTGCTGGTGACGGGTGGTACGGGTGGTCTGGGCCGTGAG
GTGGCGCGTCACCTGGTGGCGGTGCACGGGGTGCGGGATCTGCTGCTGCTGAACCGTAGT
GGTGGCGGCGCCGAACTCGTGGCGGAGCTGGCGGAGTTGGGGGCGCGGGCGCGTGTGGTC
GCGTGTGACGTCGCGGATCGTGCGGCGCTGGCCGAGGTGTTGGCCGGTGTCGCCCTGACC
GGGGTGGTGCACACGGCCGGTGTCGTCGAGGACGCGGTGATCACCTCCCTGGACACCGAG
CGGTTGGATCGGGTGTTGGCGCCGAAGGTGGATGCGGCGTGGTATCTGCACGAGTTGACG
GCGGGGATGGATCTGTCGGCGTTCGTGGTGTTCTCGTCGTTGGCCGGTGTGGTGGGTAGT
CCGGGGCAGGGCAACTACGCGGCGGGCAACGTGTTCCTGGACGCGTTGATGCAGTATCGG
CGGCTGGAGGGGTTGCCGGCGGTGTCGATGGCCTGGGGTCCGTGGGCCCAAGGTGCGGGT
CTGACGGGTGAGTTGTCGGACGCGGACATGCGGCGGATCACGGCGTCGGGAACGCCGCCG
TTCACGGTGGAGCAGGGCCTGGCGGTGTTCGACGCGGCCCTGGGCAGCCCGGAGGCGGCC
GTCGCCCTGACCCGGCTCGACCTCGCGGCACTGCGGACCCGCGACGAACTGCCCCCGCTG
TGGCGCACCCTGGTCGGGCAGCCGGCCCGGCGTGCCGCCGGCGGACACCGCAACGACCCC
GACGACCTGGCCCGCCGGCTGGCCGCGCTGCCCGACGCCGATGCGCGGGACGCGTACCTG
CTGCGGCTCGTCGCCGACCACGTGGCCCTCGTCCTCGGTCACGCGCCGGGTGACGGGGTG
GACACCACGAAGGAGTTCCGTGAGCTCGGCTTCGACTCGCTGACCTCCGTCGACCTGCGG
AACCGCCTCCAGGCGACCACCGGCATGTCCCTGCCGGCGACGCTCGTCTTCGACCACCCG
GACGCCGCCACCCTGGCCGCCTTCCTCAGTGCGAGGTTCGGCGACGCCGGCCCGGCCGCC
GCCGAGCCGGAGGCGGTCGCCCCCAGGGACCCGATGCAGGACCTCTATCTCAACGCGCTG
GAGAGCGGCCGCGCCGACCTCGGTGACGCGTTCGCGCTCAGTGCCGCGCGGTTGCGCCCG
CGGTACGCCGATGCCACCGCGCTGGAGCGGCGGCCGGTGCCGGTGCGGCTGTCGGCCGGG
GACACCGGTCCGCACCTGGTCTGCGTCTGCCCGCCGCTGGCACTGAACGGACCGCAGACC
TACAACCGGTTCGCGGCCGAACTGGCCGCCGACTGGAAGGTCTCGGCCCTGGTGGCCCCG
GGCTTCGCGGCGGACGCCCCGCTGCCGGAGAACAGCCGGGTGCTGATCGCGACGCTGGCC
GACGCGGTGCAGGAGTACGTCGGCGACTCCGCGTTCGCGCTGGCCGGCCTGTCCTCCGGC
GGCGTGCTCGCCCACGAGATCGCGCGGGAACTGGAGCGCCGGGGCAGCGACCCGCTGGCG
GTGGTGCTCCTCGACTCGTATCCCATGGACAGCCCGGTGCTGAAGCGGTGGAAGAACGAG
ATGGCCCGGGTCGGCCTGGAGCGCGCCCGCGCCCTGGACCGGCGCCAGGCCGACGAGGGG
TTCCGGCTGGAGGAGATCACCGCCTCGGCCTGGATCTGCGGGGAACTGCTGCTCGACTGG
CGGCCGGAGGGACTGACGGCGCCCTCCTGCCTGGTCCGCGCCAGCGAGCCGGTGGTGGCC
GAGGACGGCGCCGGCTGGCAGACGCCGGTCGCCGCGTCGGAGGTCATCGACGTGCCGGGC
GACCACTTCAGCATCATGGACCGGCAGTTCGCGGCCTCCACCGCGGCCGCCGTGCGCGCG
TGGCTGGCGGGGGTGACCGCCCGGGTCGGTTAG
[9] KS35..402
[9] AT576..888
[9] methylmalonyl-CoA764..768
[9] DH936..1094
[9] KR1404..1580
[9] ACP1681..1751
[10] KS1774..2143
[10] AT2329..2635
[10] malonyl-CoA2514..2518
[10] DH2684..2841
[10] KR3141..3313
[10] ACP3410..3484
[11] KS3509..3883
[11] AT4054..4366
[11] methylmalonyl-CoA4242..4246
[11] KR4650..4830
[11] ACP4928..4998
[12] KS5022..5397
[12] AT5565..5871
[12] malonyl-CoA5750..5754
[12] DH5918..6074
[12] KR6386..6558
[12] ACP6660..6730
[12] TE6809..7021
[9] KS103..1206
[9] AT1726..2664
[9] methylmalonyl-CoA2290..2304
[9] DH2806..3282
[9] KR4210..4740
[9] ACP5041..5253
[10] KS5320..6429
[10] AT6985..7905
[10] malonyl-CoA7540..7554
[10] DH8050..8523
[10] KR9421..9939
[10] ACP10228..10452
[11] KS10525..11649
[11] AT12160..13098
[11] methylmalonyl-CoA12724..12738
[11] KR13948..14490
[11] ACP14782..14994
[12] KS15064..16191
[12] AT16693..17613
[12] malonyl-CoA17248..17262
[12] DH17752..18222
[12] KR19156..19674
[12] ACP19978..20190
[12] TE20425..21063

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [6809-7021]  2.3e-21 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [571-698]  G3DSA:3.40.366.10 [764-876]  G3DSA:3.40.366.10 [2317-2449]  G3DSA:3.40.366.10 [2514-2614]  G3DSA:3.40.366.10 [4049-4176]  G3DSA:3.40.366.10 [4242-4354]  G3DSA:3.40.366.10 [5553-5685]  G3DSA:3.40.366.10 [5750-5855]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1709-1724]  PS00012 [3442-3457]  PS00012 [6688-6703]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1685-1750]  9e-12 PF00550 [3418-3483]  1.8e-12 PF00550 [4934-4997]  9.30000000000002e-11 PF00550 [6664-6729]  4.3e-10 PF00550
PF00550   PP-binding
 [1674-1790]  3.80000697093586e-26 SSF47336 [3407-3523]  9.59999914716171e-29 SSF47336 [4921-5038]  2.90000354677981e-27 SSF47336
SSF47336   ACP_like
 [1681-1755]  1.29999999999998e-82 G3DSA:1.10.1200.10 [3412-3488]  1.29999999999998e-82 G3DSA:1.10.1200.10 [4925-5003]  1.29999999999998e-82 G3DSA:1.10.1200.10 [6660-6734]  1.29999999999998e-82 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1681-1751]  PS50075 [3410-3484]  PS50075 [4928-4998]  PS50075 [6660-6730]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1404-1579]  1.5e-60 PF08659 [3141-3312]  6.40000000000004e-58 PF08659 [4650-4828]  2.70000000000002e-59 PF08659 [6386-6557]  4.10000000000004e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-276]  1.79999999999997e-86 PF00109 [1774-2017]  7.59999999999998e-79 PF00109 [3509-3757]  7.09999999999991e-91 PF00109 [5022-5271]  1.79999999999997e-86 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [284-402]  2.4e-48 PF02801 [2025-2143]  5.30000000000001e-48 PF02801 [3765-3883]  1.2e-47 PF02801 [5279-5397]  3.5e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [576-888]  2.09999999999996e-94 PF00698 [2329-2635]  5.30000000000001e-57 PF00698 [4054-4366]  3.10000000000005e-95 PF00698 [5565-5871]  1.9e-60 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [574-872]  1.90000694315261e-63 SSF52151 [2324-2629]  1.3000049540733e-68 SSF52151 [4052-4350]  1.20000117458134e-63 SSF52151 [5560-5864]  5.89998809405682e-70 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [701-763]  6.39998633403535e-17 SSF55048 [2451-2513]  3.49999466863949e-17 SSF55048 [4179-4241]  2.90000354677981e-17 SSF55048 [5687-5749]  9.59999914716171e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [35-287]  G3DSA:3.40.47.10 [290-452]  G3DSA:3.40.47.10 [1774-2028]  G3DSA:3.40.47.10 [2031-2194]  G3DSA:3.40.47.10 [3510-3769]  G3DSA:3.40.47.10 [3771-3934]  G3DSA:3.40.47.10 [5025-5283]  G3DSA:3.40.47.10 [5285-5448]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [34-400]  2.0000139277205e-95 SSF53901 [1766-2141]  8.70005082121738e-93 SSF53901 [3499-3881]  7.0999832511256e-100 SSF53901 [5014-5395]  4.20003460493095e-99 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1404-1611]  G3DSA:3.40.50.720 [3142-3319]  G3DSA:3.40.50.720 [4650-4836]  G3DSA:3.40.50.720 [6387-6564]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [189-205]  PS00606 [1930-1946]  PS00606 [3670-3686]  PS00606 [5184-5200]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [578-869]  1.39999277195148e-108 SM00827 [2329-2616]  7.80005155399507e-116 SM00827 [4056-4347]  2.19999900980707e-108 SM00827 [5565-5852]  7.49999605851445e-112 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1682-1754]  4.10001399699315e-33 SM00823 [3415-3487]  6.10002656149838e-35 SM00823 [4929-5001]  3.70001063537244e-33 SM00823 [6661-6733]  2.30000440726534e-30 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [936-1094]  3.699978135861e-74 SM00826 [2684-2841]  5.10003242202156e-74 SM00826 [5918-6074]  1.69998802370953e-72 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-454]  SM00825 [1776-2195]  SM00825 [3509-3935]  SM00825 [5024-5449]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1404-1580]  1.40000506907309e-59 SM00822 [3141-3313]  3.29999077503323e-57 SM00822 [4650-4830]  3.10001307370206e-45 SM00822 [6386-6558]  8.59998776239544e-56 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit