close all open/close all

CDS information : Rever_00250


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction92,596 / 95,367 / + [in whole cluster]
92,596 / 95,367 / + [in contig]
Location92596..95367 [in whole cluster]
92596..95367 [in contig]
TypeCDS
Length2,772 bp (923 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)revU
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)
Related Reference
ACC
Q9ZGI0
NITE
Pikro_00180
PmId
[11344155] Characterization and analysis of the PikD regulatory factor in the pikromycin biosynthetic pathway of Streptomyces venezuelae. (J Bacteriol. , 2001)
[18245260] Enhanced heterologous production of desosaminyl macrolides and their hydroxylated derivatives by overexpression of the pikD regulatory gene in Streptomyces venezuelae. (Appl Environ Microbiol. , 2008)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative transcriptional regulator]
MLERDQCLDQLTELLDTCAEGNGATGVISGAVGFGKTTLLEAVVSRAAARGYMVLGAVGS
KVESAIPYAVVEQLFQSAELAGAETDLHVPLQRAKEEWSHLGMEAGAAQAMQAYHALLVE
LSAHQPVVLCVDDIQHVDSESLACLLYLIRRCRRNPVTILLTLGPSGAAPCEGVLAELAC
RPGVAHVRLGAFDEVGMARLIADRFGPAAAEQYAPGFYAMSGGNPLLAQALVSDHTARPA
HPETGYHPVAADLFREASVACTRRSGLNGLRVARGLAITNGAGSSTLLARLVGLEKRDVD
AAMKILTESRLIEGLRFRHPAIRSAVLDNMSAVDRTRLHHRVAGLLRNDGAPVIVVAQHL
IAAGAVEDDWAPQFLMDAAKQALREDRVSLAEQCLQLADNCCQDQGRSHAIKANLARIKW
RDQPEAAARIMLSLVAPARAGDLPGSLRLKVAHRLLVQGRVTDAVELMGPLFAGGADGTP
AERLTLELDVTRLWLAFTYPGVHQQLVGDLPPEQQRQVPSHQIGRPRLSAIHTLWAVLKR
GPDDVLVAEAERVLQHLLAEDDTISSLNSAIAALVYADRLESAAAWCGRLQTAATERHAP
TWHALFTSTRAMIALRRGSLRSAAESAEAALRSMSVEAWGVEIGMPLATAIEARTAMGDH
AASAELVNSPVPPGLFQTRFGLHYLYARGRHYLATGYYDAALADFIQCGEKAQEWDLDSP
ALAPWRTGAVEVWLQRGQRERAGRLADEHLALVKRGQRRTLGVALRVQAMTRPSSQQAHL
LGTAVDMLQTAGDRYELALTLVELCRTHQRQGAAAQARLLVRQAWRMASECGAEGLCSSL
MPKPVAGVPVEQPRSLPPSDDVVAGVLSEAELRVCSLAARGHTNREISDKLFVTVSTVEQ
HLTRAYRKLNIRHRRELPASLAS
selected fasta
>putative LuxR family transcriptional regulator [putative transcriptional regulator]
ATGCTGGAGCGCGACCAATGCCTCGACCAGCTCACAGAACTGCTCGACACATGCGCCGAG
GGGAACGGCGCGACGGGTGTCATCAGCGGTGCGGTCGGGTTCGGCAAGACCACGCTGCTG
GAGGCCGTGGTGTCCAGAGCCGCGGCACGCGGGTACATGGTGCTCGGTGCGGTCGGCTCC
AAGGTGGAGAGCGCGATCCCGTACGCGGTGGTGGAGCAGCTCTTCCAGAGCGCTGAACTC
GCCGGCGCCGAGACCGACCTGCACGTCCCGTTACAACGGGCCAAGGAGGAGTGGTCCCAC
CTCGGCATGGAGGCGGGAGCGGCCCAGGCCATGCAGGCGTACCACGCGCTGCTGGTCGAA
CTCAGCGCGCACCAGCCGGTCGTGCTGTGCGTCGACGACATCCAGCACGTCGACTCCGAG
TCGCTGGCCTGCCTGCTCTACCTGATCCGGCGCTGCCGCCGGAACCCGGTCACCATCCTC
CTCACGCTCGGCCCGTCCGGGGCCGCGCCCTGCGAGGGGGTGCTCGCCGAACTGGCGTGC
CGGCCCGGTGTCGCGCACGTGCGGCTGGGCGCCTTCGACGAGGTGGGCATGGCCCGGCTG
ATAGCGGACCGGTTCGGACCGGCGGCCGCGGAGCAGTACGCACCCGGGTTCTACGCGATG
AGCGGCGGCAACCCGCTGCTGGCGCAGGCCCTGGTCAGCGACCACACCGCCCGGCCCGCG
CACCCCGAGACCGGCTACCACCCGGTCGCCGCCGACCTGTTCCGCGAGGCGTCGGTGGCC
TGCACCCGCCGCAGCGGCCTGAACGGGCTGCGGGTGGCCCGGGGGCTGGCGATCACCAAC
GGCGCCGGCTCGTCCACGCTGCTCGCCCGGCTGGTCGGGCTGGAGAAGCGCGACGTGGAC
GCGGCGATGAAGATCCTCACCGAGTCCCGGCTGATCGAGGGGCTCCGCTTCCGCCACCCG
GCGATCCGCTCGGCCGTGCTGGACAACATGTCGGCCGTGGACCGCACCCGGCTGCACCAC
CGGGTCGCCGGGCTGCTGCGCAACGACGGCGCGCCCGTCATCGTGGTCGCGCAGCACCTG
ATCGCCGCGGGCGCCGTGGAGGACGACTGGGCGCCGCAGTTCCTGATGGACGCGGCCAAG
CAGGCGTTGCGCGAGGACCGGGTCTCCCTCGCGGAGCAGTGCCTGCAACTGGCCGACAAC
TGCTGCCAGGACCAGGGCCGCAGCCATGCCATCAAGGCGAACCTGGCGCGCATCAAGTGG
CGGGACCAGCCCGAGGCGGCCGCGCGCATCATGCTGTCCCTGGTCGCCCCGGCCAGGGCC
GGGGACCTGCCGGGGTCCCTGCGCCTGAAGGTCGCCCACCGGCTGCTGGTGCAGGGCCGG
GTCACCGACGCGGTCGAACTGATGGGGCCGCTGTTCGCCGGAGGCGCCGACGGGACACCG
GCGGAGCGGCTCACGCTGGAGCTGGACGTGACCCGGCTGTGGCTGGCCTTCACCTACCCC
GGGGTCCACCAGCAACTCGTGGGCGACCTCCCGCCGGAGCAGCAGCGGCAGGTGCCCTCG
CACCAGATCGGGCGGCCCCGGCTGTCGGCCATCCACACGCTCTGGGCGGTCCTCAAGCGC
GGCCCCGACGACGTGCTGGTGGCCGAGGCGGAGCGGGTGCTCCAGCACCTGCTGGCCGAG
GACGACACCATCAGCTCGTTGAACTCCGCGATCGCGGCGCTGGTCTACGCCGACCGGCTG
GAGTCGGCGGCCGCCTGGTGCGGCCGGCTCCAGACGGCCGCCACCGAGCGCCACGCCCCC
ACCTGGCACGCCCTGTTCACCTCGACACGGGCGATGATCGCGCTGCGCCGGGGCTCGCTG
CGCAGTGCCGCGGAGTCCGCGGAGGCCGCGCTGCGCAGTATGTCGGTGGAGGCATGGGGC
GTCGAGATCGGCATGCCGCTGGCCACCGCGATCGAGGCCCGGACGGCGATGGGGGACCAC
GCGGCCAGCGCCGAACTGGTCAACAGCCCGGTCCCGCCGGGCCTGTTCCAGACCCGGTTC
GGGCTGCACTACCTCTACGCCCGTGGCCGCCACTACCTGGCCACCGGCTACTACGACGCG
GCCCTCGCGGACTTCATCCAGTGCGGCGAGAAGGCGCAGGAGTGGGACCTCGACTCTCCG
GCGCTGGCGCCCTGGCGGACCGGGGCGGTGGAGGTGTGGCTCCAGCGCGGGCAGCGCGAG
CGCGCCGGCCGGCTGGCCGACGAGCACCTCGCGCTGGTCAAGCGGGGGCAGCGCCGCACC
CTGGGGGTCGCGCTGCGGGTGCAGGCCATGACGCGGCCCTCGTCGCAGCAGGCCCACCTG
CTGGGCACGGCGGTGGACATGCTCCAGACCGCCGGGGACCGCTACGAGCTGGCGCTGACG
CTGGTCGAGCTGTGCCGGACGCACCAGCGGCAGGGCGCGGCCGCGCAGGCACGGCTGCTG
GTCCGCCAGGCGTGGCGGATGGCCAGCGAGTGCGGCGCCGAGGGGCTGTGCTCGTCGCTG
ATGCCCAAGCCGGTCGCCGGTGTCCCGGTGGAGCAGCCGCGCAGCCTGCCGCCGTCCGAC
GACGTGGTGGCGGGGGTGCTCTCCGAGGCCGAGCTGCGGGTGTGTTCGCTCGCGGCCCGC
GGCCACACCAACCGGGAGATCTCCGACAAGCTCTTCGTGACGGTCAGCACCGTCGAGCAG
CACCTGACCCGGGCCTACCGGAAGCTCAACATACGGCACCGCCGCGAGCTGCCGGCCAGC
CTCGCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [866-917]  2.3e-11 PF00196
PF00196   GerE
 [864-921]  5.10001002358244e-22 SM00421
SM00421   HTH_LUXR
 [867-881]  4.99999811956429e-08 PR00038 [881-897]  4.99999811956429e-08 PR00038 [897-909]  4.99999811956429e-08 PR00038
PR00038   HTHLUXR
 [860-923]  PS50043
PS50043   HTH_LUXR_2
 [881-908]  PS00622
PS00622   HTH_LUXR_1
IPR011990 Tetratricopeptide-like helical (Domain)
 [374-413]  0.00033 G3DSA:1.25.40.10 [596-640]  0.00033 G3DSA:1.25.40.10 [683-877]  2.5e-13 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [878-917]  2e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [845-923]  5.69999708783953e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit