close all open/close all

CDS information : Rever_00260


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction96,494 / 95,517 / - [in whole cluster]
96,494 / 95,517 / - [in contig]
Locationcomplement(95517..96494) [in whole cluster]
complement(95517..96494) [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf1
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[hypothetical protein]
MSSLKSTFTVYPHTRALAEGAVELPGGPLEFVPTKPIIRAYREMVRELAYDVCELAPTTY
LMARAAGVPVIAVPVFTKRLFHHGHIRCHAASGIRVPGDLVGRTVGVRAYSVTTGVWVRG
LLSDDFGVDPAEVRWVTDDEEHVASYVAPPNVSAVAPGESLVDLLDQGRIDAALTGNAGV
GRKGAPKDGWTTGDSGPRPAAEPPYSLFGTPEPLERDWYRRTGVYPIHGVIVVREELVRD
NPRLATDLYAAFAAAKRAAGAGRAELVAALAAGAAVPDDEDPIPYGVEPNARSLEALIRY
AREQHLLDTPVSVEEIFAPGDYPTA
selected fasta
>[hypothetical protein]
GTGTCCTCGCTGAAGTCGACGTTCACCGTCTATCCGCACACCCGGGCGCTGGCCGAGGGC
GCCGTCGAGCTGCCCGGCGGCCCGCTGGAGTTCGTCCCGACGAAGCCGATCATCCGGGCC
TACCGCGAGATGGTCCGCGAACTCGCGTACGACGTGTGCGAGTTGGCGCCGACCACGTAT
CTGATGGCACGCGCCGCCGGCGTGCCGGTGATCGCCGTCCCGGTCTTCACCAAGCGGCTC
TTCCACCACGGGCACATCCGCTGCCATGCCGCGTCCGGCATCCGGGTGCCCGGCGACCTC
GTCGGCCGCACGGTCGGTGTGCGCGCCTACTCGGTGACCACCGGAGTGTGGGTACGCGGC
CTGCTGTCAGACGATTTCGGCGTCGACCCGGCCGAGGTCCGCTGGGTCACCGACGACGAG
GAGCACGTCGCGAGCTACGTCGCGCCGCCGAACGTCTCGGCGGTCGCGCCCGGCGAGAGC
CTGGTGGACCTGCTCGACCAGGGCCGGATCGACGCCGCGCTGACCGGCAACGCCGGGGTC
GGCCGCAAGGGCGCGCCCAAGGACGGCTGGACGACCGGCGACAGCGGCCCGCGGCCCGCC
GCCGAACCGCCCTACTCGCTGTTCGGCACCCCCGAGCCGCTGGAGCGGGACTGGTACCGC
CGCACCGGCGTCTACCCGATCCACGGCGTGATCGTGGTGCGCGAAGAACTGGTGCGCGAC
AACCCCCGGCTCGCCACCGACCTGTACGCGGCCTTCGCCGCCGCGAAGCGCGCCGCCGGG
GCCGGCCGCGCCGAACTCGTCGCCGCGCTCGCCGCCGGCGCGGCCGTCCCGGACGACGAG
GACCCGATCCCCTACGGCGTCGAGCCGAACGCCCGGTCCCTGGAGGCCCTCATCCGCTAC
GCCCGCGAGCAGCACCTGCTCGACACCCCGGTGTCGGTCGAGGAGATCTTCGCGCCCGGC
GACTACCCGACGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit