close all open/close all

CDS information : Rever_00270


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction96,795 / 98,486 / + [in whole cluster]
96,795 / 98,486 / + [in contig]
Location96795..98486 [in whole cluster]
96795..98486 [in contig]
TypeCDS
Length1,692 bp (563 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf2
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative transporter]
MRFTPERIALTLFTLAVVALIAAPLVEVVIRSLEKQTGLTGHVWSGANYQQLKASEILSS
ARNSVVIALGSMAVATVIGVGLSWLVTRTDLPLRRAFEILNLIPFFLSPLIGSIAWTYLA
DPRTGFINRLARSAGISHGAVFNVYSTLGIIVVLGLFLVPFVILLTGAAFRQMDSSLEHA
AAACGASGWRTAVRVTLPLASPAIMAAAILTFVMAIEDLSVPLVLGYGNGIQTLSTRIYD
AVQTFPPNYNFGAALGCVMMLITALCLYLQRRAMRDRGYVTVTGKGSRAEPLRLGRIRWW
AFAAELVYLLFAALLPIGILTLIAFSKRWTGTVDFGDLTLDNFRALFGKGSIVRTAFLNS
LELSALCACVVVALSVVLVHAIERARITGRRLFEVCLTIPVAVPGLVLGVGLLTLLLKTS
LFGTLWIIGVAYVVRFLPFAHRSVSAAFLSVHTELEEAARTSGASLGRYVFRVLLPLVRP
GLVSGWLLVFLTFMRELPMSALLQTTGTQTLSVALLNSRSFDSPGVTAAFTLLQAAVLLV
AAAVFWTITTRRDGASSDMAAGL
selected fasta
>[putative transporter]
GTGCGGTTCACCCCGGAGCGCATCGCGCTCACGCTGTTCACCCTGGCCGTGGTCGCCCTG
ATCGCGGCACCGCTGGTGGAAGTCGTCATCCGCTCGCTCGAGAAGCAGACCGGTCTGACC
GGCCACGTGTGGTCCGGTGCGAACTACCAGCAGCTCAAGGCGTCGGAGATCCTCAGCTCC
GCCCGCAACAGCGTGGTCATCGCCCTCGGGTCGATGGCGGTGGCCACCGTCATCGGCGTC
GGGCTGTCGTGGCTGGTCACCCGCACCGACCTGCCCCTGCGACGGGCGTTCGAGATCCTC
AACCTGATCCCGTTCTTCCTGTCCCCGCTGATCGGCTCGATCGCCTGGACCTACCTGGCC
GACCCGCGGACCGGGTTCATCAACCGGCTGGCCCGCAGCGCCGGGATCAGCCACGGGGCG
GTCTTCAACGTCTACTCCACGCTCGGCATCATCGTCGTGCTCGGCCTGTTCCTGGTGCCG
TTCGTCATCCTGCTCACCGGCGCGGCCTTCCGGCAGATGGACTCCTCGCTGGAGCACGCG
GCGGCCGCCTGCGGCGCGTCAGGCTGGCGGACGGCGGTCCGCGTGACGCTCCCGCTGGCC
AGCCCGGCGATCATGGCGGCCGCGATCCTGACGTTCGTCATGGCGATCGAGGACCTGTCG
GTGCCGCTGGTGCTCGGCTACGGCAACGGGATCCAGACGCTGTCCACCCGCATCTACGAC
GCGGTCCAGACGTTCCCGCCGAACTACAACTTCGGCGCCGCGCTCGGCTGCGTGATGATG
CTCATCACCGCGCTGTGCCTGTACCTCCAGCGCCGCGCCATGCGCGACCGCGGCTACGTC
ACGGTCACCGGCAAGGGCTCGCGGGCCGAACCGCTGCGGCTGGGGCGGATCCGCTGGTGG
GCCTTCGCGGCCGAACTGGTCTACCTGCTGTTCGCCGCGCTCCTGCCGATCGGCATCCTC
ACGCTGATCGCGTTCTCCAAACGCTGGACCGGGACGGTCGACTTCGGCGACCTGACCCTG
GACAACTTCCGCGCGCTGTTCGGGAAGGGCTCGATCGTCAGGACCGCGTTCCTCAACAGC
CTGGAGCTGTCCGCGCTGTGCGCCTGCGTGGTCGTCGCGCTCAGCGTCGTGCTCGTCCAC
GCGATCGAGCGGGCCAGGATCACCGGCCGCCGGCTGTTCGAGGTCTGCCTGACGATCCCC
GTCGCGGTGCCGGGCCTGGTGCTGGGCGTCGGGCTGCTCACCCTGCTGCTCAAGACCTCG
CTGTTCGGCACGCTGTGGATCATCGGCGTCGCCTACGTCGTACGGTTCCTGCCGTTCGCC
CATCGCTCGGTGTCGGCGGCGTTCCTGTCGGTGCACACCGAACTGGAGGAGGCCGCCCGC
ACCAGCGGGGCGTCCCTGGGGCGCTACGTCTTCCGGGTGCTGCTGCCGCTGGTCCGCCCG
GGACTGGTGTCCGGATGGCTGCTGGTCTTCCTCACCTTCATGCGCGAACTGCCGATGTCG
GCCCTGCTGCAGACGACCGGGACACAGACGCTCTCGGTGGCCCTGCTCAACAGCCGGTCC
TTCGACTCCCCGGGCGTGACGGCCGCGTTCACCCTGCTGCAGGCGGCCGTCCTGCTGGTG
GCCGCGGCGGTCTTCTGGACGATCACCACGCGCCGCGACGGCGCCTCCTCCGACATGGCG
GCCGGACTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [61-270]  PS50928 [357-545]  PS50928
PS50928   ABC_TM1
 [79-267]  4.29999999999998e-18 PF00528 [388-542]  2e-12 PF00528
PF00528   BPD_transp_1
SignalP
 [1-22]  0.986 Signal
Bacteria, Gram-negative   
 [1-22]  0.634 Signal
Eukaryota   
 [1-22]  0.966 Signal
Bacteria, Gram-positive   
TMHMM
 [7-29]  Transmembrane (i-o) [64-86]  Transmembrane (o-i) [98-120]  Transmembrane (i-o) [148-170]  Transmembrane (o-i) [191-213]  Transmembrane (i-o) [250-269]  Transmembrane (o-i) [306-325]  Transmembrane (i-o) [360-382]  Transmembrane (o-i) [395-417]  Transmembrane (i-o) [422-439]  Transmembrane (o-i) [469-491]  Transmembrane (i-o) [526-548]  Transmembrane (o-i)
Transmembrane 12