close all open/close all

CDS information : Rever_00280


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction98,486 / 99,700 / + [in whole cluster]
98,486 / 99,700 / + [in contig]
Location98486..99700 [in whole cluster]
98486..99700 [in contig]
TypeCDS
Length1,215 bp (404 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf3
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative transporter]
MGRKTMKTSTGGRTAPAPSPAPAETAPPRRTGHLEVAGLTRDFGSGGVRDASFSVERGQL
VTLLGPSGCGKTTTLRCLAGIEVPDAGRVRLGDTTMTATAEGVHLRPAKRDIGMVFQSYA
LWPHMSVFENVAFPLRTRGERTAAIRPRVEEMLELVGLEGMGRRQPSQLSGGQQQRVALA
RALVYRPGLLLLDEPLSNLDAARRDAVRRDIGRLQRELAITAVYVTHDQDEAMTLSDRIL
VMRDGAIVQNGTPAELLAAPRSLFVAGLLGQINVLTGVLATERTRTGPNGTERVGGVDIA
LADGTTRLSARLVGPAAVGENVSVVWRPGDITIDTAADDPSAPDRVNALPGTVTAVRVGS
SVTEYDIDAGITTLRALGLGRATASVGSRVHVSCPVDRSISLTH
selected fasta
>[putative transporter]
ATGGGCAGGAAGACGATGAAGACATCCACCGGCGGGCGGACCGCGCCCGCGCCGTCCCCC
GCGCCGGCCGAGACCGCGCCGCCGCGTCGCACCGGACACCTGGAGGTCGCCGGACTCACC
CGGGACTTCGGTTCCGGCGGAGTGCGCGACGCCTCGTTCTCGGTCGAGCGCGGCCAACTG
GTCACGCTGCTGGGCCCCTCGGGCTGCGGCAAGACGACCACCCTGCGCTGCCTGGCCGGC
ATCGAGGTCCCCGACGCGGGCCGGGTCCGGCTCGGCGACACGACGATGACCGCCACGGCC
GAGGGGGTGCACCTGCGGCCGGCCAAGCGCGACATCGGCATGGTCTTCCAGTCCTACGCG
CTGTGGCCGCACATGAGCGTCTTCGAGAACGTCGCCTTCCCGCTGCGCACCCGCGGTGAG
CGCACCGCCGCCATCCGGCCCCGCGTCGAGGAGATGCTCGAACTGGTCGGGCTGGAGGGC
ATGGGCCGGCGCCAGCCCAGCCAGCTCAGCGGCGGCCAGCAGCAGCGCGTCGCCCTCGCC
CGCGCCCTGGTCTACCGCCCCGGGCTGCTGCTGCTCGACGAGCCGCTCAGCAACCTCGAC
GCGGCCCGGCGCGACGCCGTACGCCGGGACATCGGCCGGCTGCAACGGGAGCTGGCCATC
ACCGCCGTCTACGTCACCCACGACCAGGACGAGGCGATGACGCTCTCCGACCGCATCCTG
GTGATGCGGGACGGCGCCATCGTCCAGAACGGGACGCCGGCCGAACTCCTCGCCGCGCCC
CGGTCCCTGTTCGTCGCCGGCCTGCTCGGCCAGATCAACGTCCTCACCGGCGTGCTGGCC
ACCGAGCGGACCCGGACCGGACCGAACGGCACCGAACGCGTCGGCGGGGTGGACATCGCC
CTGGCCGACGGCACGACCCGCCTGTCGGCCCGCCTCGTCGGGCCGGCCGCGGTCGGCGAG
AACGTGTCGGTCGTGTGGCGCCCCGGCGACATCACGATCGACACCGCCGCGGACGACCCG
TCGGCGCCGGACCGCGTGAACGCGCTGCCCGGCACCGTCACCGCCGTCCGCGTCGGCAGC
TCGGTCACCGAGTACGACATCGACGCCGGGATCACCACCCTGCGGGCCCTCGGCTTGGGA
CGCGCGACCGCGTCCGTCGGCTCCCGCGTCCACGTGTCCTGTCCGGTGGACAGGTCCATA
TCCCTCACCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [29-269]  PS50893
PS50893   ABC_TRANSPORTER_2
 [72-196]  5.69999999999998e-23 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [57-246]  2.60000517657733e-19 SM00382
SM00382   AAA
IPR008995 Molybdate/tungstate binding (Domain)
 [271-404]  6.30000254573022e-07 SSF50331
SSF50331   MOP_like
IPR017871 ABC transporter, conserved site (Conserved_site)
 [169-183]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-23]  0.682 Signal
Bacteria, Gram-positive   
 [1-23]  0.494 Signal
Bacteria, Gram-negative   
TMHMM No significant hit