close all open/close all

CDS information : Rever_00290


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction99,718 / 100,890 / + [in whole cluster]
99,718 / 100,890 / + [in contig]
Location99718..100890 [in whole cluster]
99718..100890 [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative peptidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf4
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative peptidase]
MPFDTIVRSASTFGPMQTDWETRIDMDRLRTERLAKTRAAMAAADVDFLIELRAENARYS
TGIKRLYWPTIQLGGGPLAVLAAEGDSAIWIIDPDYAAKNIPWVPDDRFHTPYQMDMTQD
VNSFVDDLYHYFGSKIETARIAVDIWSPSMFDVLTRRLPNATFVNGQELMIGARQIKTAD
EIKALKIAYAISEAGMQAAVNILKPGVRECELVGECFRAMWDLGTETTQCSEVVNSGPGA
HPYRRFHSDRIVQHGDLVNMDFGGCFSGYFGDFCRAFVCGDKPTPAQVDLLKRAHELQYE
QLNALGPGVSPADICAKLGRRTLGHGIGISAFEGPHLRAQDDYELKPGMTFSVTSPPIGE
EGVGGVHLEDEIVITETGIDLYSTYPYTLG
selected fasta
>[putative peptidase]
ATGCCCTTCGACACGATCGTGCGATCCGCGAGCACCTTCGGCCCGATGCAGACCGACTGG
GAGACGCGCATCGACATGGACCGGCTGCGCACCGAGCGGCTGGCGAAGACCCGCGCGGCG
ATGGCGGCCGCCGACGTCGACTTCCTGATCGAACTGCGCGCCGAGAACGCCCGCTACAGC
ACCGGCATCAAGCGGCTGTACTGGCCGACCATCCAGTTGGGCGGCGGCCCGCTGGCCGTC
CTGGCCGCCGAGGGCGACTCGGCGATCTGGATCATCGACCCGGACTACGCGGCCAAGAAC
ATCCCCTGGGTGCCGGACGACCGGTTCCACACCCCGTACCAGATGGACATGACCCAGGAC
GTCAACTCCTTCGTCGACGACCTGTACCACTACTTCGGCTCGAAGATCGAGACCGCCCGC
ATCGCGGTGGACATCTGGTCGCCGTCCATGTTCGACGTGCTGACCAGGCGGCTGCCCAAC
GCCACCTTCGTCAACGGCCAGGAGCTGATGATCGGCGCCCGCCAGATCAAGACCGCCGAC
GAGATCAAGGCCCTGAAGATCGCCTACGCCATCTCCGAGGCCGGCATGCAGGCCGCGGTC
AACATCCTCAAGCCCGGCGTGCGCGAGTGCGAACTGGTCGGCGAGTGCTTCCGCGCCATG
TGGGACCTGGGCACCGAGACCACCCAGTGCTCGGAGGTCGTCAACTCCGGGCCGGGCGCG
CACCCCTACCGCCGCTTCCACAGCGACCGGATCGTGCAGCACGGCGACCTGGTCAACATG
GACTTCGGCGGCTGCTTCTCCGGCTACTTCGGCGACTTCTGCCGCGCCTTCGTCTGCGGC
GACAAGCCCACCCCCGCCCAGGTGGACCTGCTCAAGCGGGCCCACGAGTTGCAGTACGAG
CAGCTCAACGCGCTCGGCCCCGGCGTCAGCCCGGCCGACATCTGCGCCAAGCTCGGCCGC
AGGACCCTCGGTCACGGCATCGGCATCTCCGCCTTCGAGGGCCCGCACCTGCGCGCCCAG
GACGACTACGAGCTCAAGCCCGGCATGACCTTCTCCGTCACCAGCCCGCCCATCGGCGAG
GAGGGTGTCGGCGGCGTCCACCTGGAGGACGAGATCGTCATCACCGAGACCGGCATCGAC
CTGTACTCGACCTACCCCTACACGCTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000587 Creatinase (Domain)
 [33-176]  1e-07 PF01321
PF01321   Creatinase_N
IPR000994 Peptidase M24, structural domain (Domain)
 [174-385]  1.79999754022375e-46 SSF55920
SSF55920   Peptidase_M24_cat_core
 [176-388]  3.40000000000004e-41 G3DSA:3.90.230.10
G3DSA:3.90.230.10   Peptidase_M24_cat_core
 [185-376]  1.5e-26 PF00557
PF00557   Peptidase_M24
SignalP No significant hit
TMHMM No significant hit