close all open/close all

CDS information : Rever_00300


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction100,893 / 101,957 / + [in whole cluster]
100,893 / 101,957 / + [in contig]
Location100893..101957 [in whole cluster]
100893..101957 [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf5
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative oxidoreductase]
MSGNRTPAAGWLVVGVGRHVDRYGLPALARARGAAAVALCGTDPVRTADLAERHGVGRWG
ASVEELLGDPGVTHVYVCSRNERHERHVTLAAAAGKHVLCEKPLAQDPAAARRTVAACAR
YGVVLGTGFHLRHNAAHREARRLVADGAIGRPLWVDVSYLHQVGHGDSAARLAASRTVTT
PSKGAMAGTGAHAVDLAQWLAGDRVVRLSATLAELDPTPAGPQRVVQVSATTRGGVLVTL
TAGRTTHPANGLTVIGEAGRLTVSESIGNTGGGTLSLRSAQGSTDTVFPPHDVYAAQFEA
FAAATGGAAAAPFGASGDDGLSALSVAETVDRALAGPAATQAVDPPARPTRGTP
selected fasta
>[putative oxidoreductase]
TTGTCCGGCAACCGTACGCCGGCCGCCGGCTGGCTCGTCGTGGGCGTCGGCCGCCACGTG
GACCGCTACGGTCTGCCGGCGCTCGCCCGCGCCCGCGGCGCCGCGGCCGTGGCCCTGTGC
GGGACCGACCCTGTCCGCACCGCCGACCTGGCGGAGCGGCACGGGGTCGGCCGGTGGGGC
GCCTCGGTCGAGGAACTGCTCGGCGACCCCGGCGTCACCCACGTCTACGTCTGCTCCCGC
AACGAGCGGCACGAGCGGCACGTCACGCTCGCCGCCGCGGCCGGCAAGCACGTCCTGTGC
GAGAAGCCGCTCGCGCAGGACCCGGCCGCGGCCCGCCGCACCGTCGCGGCCTGCGCGCGG
TACGGCGTCGTCCTCGGCACCGGCTTCCACCTGCGGCACAACGCCGCGCACCGGGAGGCG
CGGCGGCTGGTGGCCGACGGCGCGATCGGCCGCCCGCTGTGGGTGGACGTGTCCTACCTG
CACCAGGTGGGACACGGCGACTCCGCCGCGCGGCTGGCCGCCTCGCGCACGGTCACCACC
CCCAGCAAGGGGGCGATGGCGGGAACCGGGGCCCACGCCGTGGACCTCGCGCAGTGGCTG
GCCGGCGACCGCGTCGTCCGGCTGTCGGCGACGCTCGCCGAACTCGACCCGACACCGGCC
GGGCCGCAGCGCGTGGTCCAGGTCAGCGCGACCACCCGCGGCGGGGTGCTGGTCACCCTC
ACCGCGGGACGCACGACCCACCCGGCCAACGGGCTGACCGTGATCGGCGAGGCGGGGCGG
CTGACGGTGTCGGAGTCGATCGGGAACACCGGCGGCGGCACGCTGTCGCTCCGGTCGGCG
CAGGGCAGCACCGACACCGTCTTCCCCCCGCACGACGTCTACGCGGCGCAGTTCGAGGCG
TTCGCCGCCGCCACCGGCGGCGCGGCCGCCGCCCCGTTCGGCGCGTCCGGCGACGACGGG
CTGTCGGCGCTGAGCGTCGCGGAGACCGTGGACCGGGCCCTGGCCGGACCAGCAGCTACG
CAGGCCGTCGATCCGCCGGCCCGCCCGACCCGAGGAACACCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [11-129]  1.2e-21 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [141-244]  1.6e-07 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [10-149]  4.10000000000004e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit