close all open/close all

CDS information : Rever_00310


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction101,954 / 102,976 / + [in whole cluster]
101,954 / 102,976 / + [in contig]
Location101954..102976 [in whole cluster]
101954..102976 [in contig]
TypeCDS
Length1,023 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf6
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative dehydrogenase]
MTVVNTVITKKLGYLATTERMLAALGPVAYCPDQRPETVREHLADARIVVATKGVTIDDA
VLDAAPHVRLIAAPTAGFDWIDVEAATRRGIPVVANTGAAADAVAEFTLGAVLALTRRIV
AADRDLHGSADWGPVRDRYSRADQQIGSDLTSSTVAVVGLGHIGLKTAEKLAVLRPQSII
GYDPFVPAERARQAGVEVVGDLHELAARADIVLLHVPLTPQTTRLVDAAFLARLRPSALL
VNPSRGEVVDEPALVAALREGRLRGAALDVFEQEPLPADSPLRGMDNVVLTPHIGGVTAQ
SDETRAREIAERVLACVAGTRPVGLVNPEVWDTRLAATTD
selected fasta
>[putative dehydrogenase]
GTGACCGTTGTGAACACCGTCATCACCAAGAAACTGGGCTACCTCGCCACCACCGAGCGG
ATGCTCGCGGCGCTCGGCCCGGTCGCCTACTGCCCGGACCAGCGCCCGGAGACGGTGCGC
GAGCACCTCGCCGACGCCCGGATCGTCGTGGCCACCAAGGGCGTCACCATCGACGACGCC
GTCCTCGACGCGGCACCGCACGTCCGCCTCATCGCCGCGCCCACCGCCGGCTTCGACTGG
ATCGACGTCGAGGCGGCCACCCGCCGCGGCATCCCGGTCGTCGCCAACACCGGCGCGGCG
GCGGACGCGGTCGCCGAGTTCACGCTCGGCGCCGTGCTGGCCCTCACCCGCCGTATCGTG
GCCGCCGACCGCGACCTGCACGGCAGCGCCGACTGGGGCCCGGTGCGCGACCGCTACTCC
CGGGCCGACCAGCAGATCGGCTCCGACCTGACCAGCAGCACGGTGGCCGTCGTGGGGCTG
GGCCACATCGGGCTGAAGACCGCCGAGAAACTCGCGGTGCTGCGCCCGCAGTCGATCATC
GGGTACGACCCGTTCGTCCCGGCCGAGCGGGCCCGGCAGGCCGGCGTCGAGGTGGTCGGA
GACCTGCACGAACTCGCCGCCCGGGCCGACATCGTGCTGCTGCACGTCCCGCTGACGCCG
CAGACCACCCGGCTGGTCGACGCGGCCTTCCTGGCGAGGCTGCGGCCCTCCGCCCTGCTG
GTCAACCCCTCGCGCGGCGAGGTGGTCGACGAGCCCGCGCTGGTCGCCGCGCTGCGCGAG
GGCCGGCTGCGGGGCGCCGCGCTCGACGTGTTCGAGCAGGAGCCGCTGCCCGCTGACTCG
CCGCTGCGCGGCATGGACAACGTCGTGCTCACCCCGCACATCGGCGGCGTCACCGCGCAG
TCGGACGAGACCCGGGCCCGGGAGATCGCCGAGCGCGTCCTCGCCTGCGTCGCCGGCACG
CGACCGGTCGGCCTGGTCAACCCCGAGGTCTGGGACACCCGGCTCGCCGCCACCACTGAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006139 D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain (Domain)
 [27-327]  1.99999999999999e-21 PF00389
PF00389   2-Hacid_dh
IPR006140 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding (Domain)
 [110-295]  2.89999999999999e-53 PF02826
PF02826   2-Hacid_dh_C
 [234-250]  PS00671
PS00671   D_2_HYDROXYACID_DH_3
 [155-183]  PS00065
PS00065   D_2_HYDROXYACID_DH_1
IPR016040 NAD(P)-binding domain (Domain)
 [16-112]  7.1e-28 G3DSA:3.40.50.720 [113-296]  5.69999999999998e-58 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit