close all open/close all

CDS information : Rever_00320


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction102,995 / 103,888 / + [in whole cluster]
102,995 / 103,888 / + [in contig]
Location102995..103888 [in whole cluster]
102995..103888 [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf7
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[putative hydrolase]
MIFCFYDKGTLGVVREGRVAPVPTDVVPAAATPQQRLVALIEGYEQAGPALENVAAHAAS
HGTPLAEVALEAPVPAPTQLLCAVKNYSDDRQGVEADFFLKSILSIVPTGSTVSLPPAQA
RVFHHEPELAAVIGVGGTDIPAAEAMPHVFGYTGFLDLSARDLGTTYYMKKSPRGFGPMG
PVLVTADEFADPHDLTVELSVNGTLRQRYSTGQMANRIERLIEVASSVSGLVPGDVIATG
TYHIGMGPIQDGDHVSMTIEGIGELAVDVVDPSRREWDVSALKVATGPAPVRTAAAE
selected fasta
>[putative hydrolase]
ATGATCTTCTGCTTCTACGACAAGGGCACCCTCGGCGTGGTGCGCGAGGGCCGGGTCGCC
CCCGTGCCCACCGACGTGGTCCCGGCCGCGGCCACCCCGCAGCAGCGACTCGTCGCCCTG
ATCGAGGGCTACGAGCAGGCCGGCCCCGCGCTGGAGAACGTCGCCGCGCACGCCGCCTCC
CACGGCACGCCGCTCGCCGAGGTCGCCCTGGAGGCGCCGGTGCCCGCGCCCACCCAACTG
CTGTGCGCGGTGAAGAACTACAGCGACGACCGGCAGGGCGTCGAGGCCGACTTCTTCCTG
AAGTCGATCCTGTCGATCGTGCCGACCGGCAGCACCGTCAGCCTGCCGCCCGCCCAGGCC
CGGGTCTTCCACCACGAACCCGAACTCGCCGCCGTCATCGGCGTGGGCGGCACCGACATC
CCGGCCGCCGAGGCCATGCCGCACGTCTTCGGCTACACCGGCTTCCTGGACCTGTCGGCG
CGCGACCTCGGCACCACCTACTACATGAAGAAGTCGCCGCGCGGCTTCGGCCCGATGGGC
CCGGTGCTGGTGACCGCCGACGAGTTCGCCGACCCGCACGACCTCACCGTCGAACTGTCG
GTCAACGGCACGCTGCGGCAGCGCTACTCCACCGGGCAGATGGCCAACCGGATCGAGCGG
CTGATCGAGGTGGCCTCGTCGGTCAGCGGCCTGGTGCCCGGCGACGTGATCGCCACCGGG
ACCTACCACATCGGCATGGGACCGATCCAGGACGGCGACCACGTCAGCATGACCATCGAG
GGCATCGGCGAGCTGGCCGTCGACGTGGTCGACCCGAGCCGGCGGGAGTGGGACGTCAGC
GCGCTCAAGGTCGCCACCGGCCCGGCGCCGGTCCGGACGGCGGCGGCGGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002529 Fumarylacetoacetase, C-terminal (Domain)
 [90-270]  3.60000000000002e-42 PF01557
PF01557   FAA_hydrolase
IPR011234 Fumarylacetoacetase, C-terminal-related (Domain)
 [72-271]  4.6e-53 G3DSA:3.90.850.10
G3DSA:3.90.850.10   Fumarylacetoacetase_C-rel
 [61-270]  4.39999001237725e-48 SSF56529
SSF56529   Fumarylacetoacetase_C-rel
SignalP No significant hit
TMHMM No significant hit