close all open/close all
Rever_00320 Rever_00320   last last

CDS information : Rever_00330


close this sectionLocation

Organism
StrainSN-593
Entry nameReveromycin
Contig
Start / Stop / Direction103,885 / 104,853 / + [in whole cluster]
103,885 / 104,853 / + [in contig]
Location103885..104853 [in whole cluster]
103885..104853 [in contig]
TypeCDS
Length969 bp (322 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in reveromycin biosynthesis.
Note (GenBank)
  • orf8
Reference
ACC
PmId
[21642985] Reveromycin A biosynthesis uses RevG and RevJ for stereospecific spiroacetal formation. (Nat Chem Biol. , 2011)

close this sectionSequence

selected fasta
>[hypothetical protein]
MTISAVFGSKSALAALRAHRWASTTDTFSFADITPVHRAFPGVVEGAYDVAELALVTFLQ
ALDNGRPVTLLPVTLLGRFQHHCLVTAKETAGLRADSLAGKRIGVRAWTQTTGVWVRGFL
RDDHGVDVGDVEWVVYEGGHVDGFADPPYATRSTSGNTLPVDFLAGAVDAAILGNELPDD
PRARTLLPDPARAAAGWYGRTGAIPVNHVVVASDDFARANAHLVAEVCEVLGASVPHPPA
VSSSPDLHPRGFDALQPSLDLAGRYAYEQGIISRPITAAEVRARTEDLTGIDLGHIADPA
DRVDPADRAAPADRAEPAAPAG
selected fasta
>[hypothetical protein]
ATGACGATCTCCGCCGTCTTCGGCTCGAAGTCCGCCCTCGCCGCCCTGCGGGCGCACCGA
TGGGCGTCGACCACCGACACCTTCTCCTTCGCCGACATCACCCCGGTGCACCGCGCCTTC
CCCGGCGTGGTCGAAGGGGCGTACGACGTGGCCGAACTCGCCCTGGTCACCTTCCTCCAG
GCGCTGGACAACGGCCGGCCGGTGACGCTGCTGCCGGTCACCCTGCTCGGGCGCTTCCAG
CACCACTGCCTGGTCACCGCCAAGGAGACCGCCGGCCTAAGGGCCGACTCCCTGGCCGGC
AAGCGGATCGGCGTGCGGGCCTGGACCCAGACCACCGGGGTGTGGGTGCGCGGTTTCCTG
CGCGACGACCACGGCGTGGACGTCGGCGACGTCGAGTGGGTCGTCTACGAGGGCGGCCAC
GTGGACGGGTTCGCCGACCCGCCCTACGCCACCCGCTCCACCAGCGGCAACACCCTGCCG
GTCGACTTCCTCGCCGGGGCGGTCGACGCGGCGATCCTCGGCAACGAACTGCCGGACGAC
CCGCGGGCCAGGACGCTGCTGCCCGATCCGGCCCGCGCCGCCGCCGGGTGGTACGGCCGG
ACCGGCGCGATCCCGGTCAACCACGTGGTGGTGGCGAGCGACGACTTCGCCCGGGCCAAC
GCCCACCTGGTCGCCGAGGTCTGCGAGGTGCTCGGCGCGAGCGTGCCGCACCCGCCGGCG
GTCAGCTCGTCGCCCGACCTCCACCCGCGCGGGTTCGACGCGCTCCAGCCGTCGCTGGAC
CTGGCCGGCCGCTACGCCTACGAGCAGGGCATCATCTCGCGGCCGATCACCGCCGCCGAG
GTGCGGGCCAGGACCGAGGACCTGACCGGTATCGACCTCGGACACATCGCCGACCCCGCC
GACCGAGTCGACCCCGCCGACCGAGCCGCACCCGCCGACCGAGCCGAACCGGCCGCACCC
GCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-30]  0.453 Signal
Bacteria, Gram-positive   
 [1-14]  0.588 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Rever_00320 Rever_00320   last last