close all open/close all
first first   Rifam_00020 Rifam_00020

CDS information : Rifam_00010


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction145 / 720 / + [in whole cluster]
145 / 720 / + [in contig]
Location145..720 [in whole cluster]
145..720 [in contig]
TypeCDS
Length576 bp (191 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.2 translation
Productputative 50S ribosomal protein L10
Product (GenBank)RplJ
Gene
Gene (GenBank)rplJ
EC number
Keyword
Note
Note (GenBank)
  • ribosomal protein L10
Reference
ACC
Related Reference
ACC
P0A7J3
PmId
[3049601] In vivo and in vitro structural analysis of the rplJ mRNA leader of Escherichia coli. Protection by bound L10-L7/L12. (J Biol Chem. , 1988)
[10747797] Deletion of C-terminal residues of Escherichia coli ribosomal protein L10 causes the loss of binding of one L7/L12 dimer: ribosomes with one L7/L12 dimer are active. (Biochemistry. , 2000)

close this sectionSequence

selected fasta
>putative 50S ribosomal protein L10 [RplJ]
MPLLVPNRDRKAGVVQPSSIAESFRTSSATVVTQYTGLSVSQLSQLRRALGTSAKYRVAK
NTLVKRAAEDAGIQGLEDLFVGATAIAFVEGEAVDAAKAIRDFAKDNNALVIKGGYMDGR
ALSVDEINRIADLDSREVLLAKAAGAFKAKLSQAAALFQAPASQVARLAAALEEKQRNAA
GTEAAEAPAES
selected fasta
>putative 50S ribosomal protein L10 [RplJ]
ATGCCGTTGTTGGTGCCGAACAGGGACCGGAAGGCCGGCGTCGTCCAGCCGAGCTCGATC
GCGGAGAGCTTCCGCACCAGCTCGGCCACCGTCGTTACCCAGTACACCGGCCTCTCCGTG
TCCCAGCTGTCCCAGCTGCGCCGCGCTCTCGGCACCAGTGCCAAGTACCGGGTCGCGAAG
AACACCCTGGTCAAGCGGGCGGCCGAGGACGCCGGCATCCAGGGTCTCGAGGACCTGTTC
GTCGGCGCGACCGCCATCGCCTTCGTCGAGGGTGAAGCAGTCGACGCCGCCAAGGCGATT
CGCGACTTCGCGAAGGACAACAACGCGCTTGTGATCAAGGGCGGCTACATGGACGGCCGA
GCGCTGTCCGTGGACGAGATCAACCGGATTGCCGATCTCGACAGCCGTGAGGTCCTGCTC
GCCAAGGCGGCGGGCGCGTTCAAGGCGAAGCTTTCCCAGGCCGCCGCGCTGTTCCAGGCG
CCGGCGTCCCAGGTCGCCCGCCTGGCTGCCGCGCTGGAGGAGAAGCAGCGCAACGCCGCC
GGTACCGAAGCAGCCGAAGCACCCGCCGAGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001790 Ribosomal protein L10/acidic P0 (Family)
 [7-105]  2.90000000000001e-24 PF00466
PF00466   Ribosomal_L10
SignalP No significant hit
TMHMM No significant hit
first first   Rifam_00020 Rifam_00020