close all open/close all

CDS information : Rifam_00020


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction770 / 1,153 / + [in whole cluster]
770 / 1,153 / + [in contig]
Location770..1153 [in whole cluster]
770..1153 [in contig]
TypeCDS
Length384 bp (127 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.2 translation
Productputative 50S ribosomal protein L7/L12
Product (GenBank)RplL
Gene
Gene (GenBank)rplL
EC number
Keyword
Note
Note (GenBank)
  • ribosomal protein L7/L12
Reference
ACC
Family/Domain
FD
IPR000206

close this sectionSequence

selected fasta
>putative 50S ribosomal protein L7/L12 [RplL]
MAKLSTAELIDAFKELTLLELSEFVKEFEEVFDVTAAAPVAVAAGPAAAAAAPVEEQDEF
DVVLEGAGDKKIQVIKVVREVVSGLGLKEAKELVEAAPKALLEKVDKEAAEAAKEKLEAA
GAKISIK
selected fasta
>putative 50S ribosomal protein L7/L12 [RplL]
ATGGCGAAGCTGAGCACCGCCGAGCTGATCGACGCCTTCAAGGAGCTGACCCTCCTCGAG
CTGTCCGAGTTCGTGAAGGAGTTCGAAGAGGTCTTCGACGTGACCGCCGCCGCGCCGGTC
GCCGTTGCCGCCGGCCCGGCCGCCGCCGCTGCCGCCCCGGTCGAGGAGCAGGACGAGTTC
GACGTCGTCCTCGAGGGCGCCGGCGACAAGAAGATCCAGGTCATCAAGGTCGTCCGCGAG
GTCGTCTCGGGCCTGGGCCTGAAGGAGGCCAAGGAGCTGGTCGAGGCCGCTCCCAAGGCC
CTCCTGGAGAAGGTCGACAAGGAGGCCGCCGAGGCCGCCAAGGAGAAGCTCGAGGCCGCG
GGCGCCAAGATTTCCATCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000206 Ribosomal protein L7/L12 (Family)
 [3-127]  23.814 MF_00368
MF_00368   Ribosomal_L7_L12
 [1-127]  3e-47 TIGR00855
TIGR00855   L12: ribosomal protein L7/L12
IPR008932 Ribosomal protein L7/L12, oligomerisation (Domain)
 [4-62]  1.4e-15 SSF48300
SSF48300   Ribosomal protein L7/12, oligomerisation (N-terminal) domain
IPR013823 Ribosomal protein L7/L12, C-terminal (Domain)
 [61-98]  4e-13 PD001326
PD001326   Q7BUF6_AMYMD_Q7BUF6;
 [59-127]  2.9e-27 PF00542
PF00542   Ribosomal_L12
IPR014719 Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (Domain)
 [54-127]  1.5e-27 G3DSA:3.30.1390.10
G3DSA:3.30.1390.10   no description
 [59-127]  2.6e-22 SSF54736
SSF54736   ClpS-like
SignalP No significant hit
TMHMM No significant hit