close all open/close all

CDS information : Rifam_00030


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction1,559 / 2,731 / + [in whole cluster]
1,559 / 2,731 / + [in contig]
Location1559..2731 [in whole cluster]
1559..2731 [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)putative ABC transporter ATP-binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF21
Reference
ACC
Related Reference
ACC
Q9Z402
PmId
[9658016] Isolation and characterization of toluene-sensitive mutants from the toluene-resistant bacterium Pseudomonas putida GM73. (J Bacteriol. , 1998)
Family/Domain
FD
IPR003439, IPR003593

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [putative ABC transporter ATP-binding protein]
MGAEVVIEGLTKSFGKQAIWRDVTLTLPPGEVSAMLGPSGTGKSVFLKSMIGLLKPDRGR
CMINGVDIVTCSEHKLYEIRKLFGVLFQDGALFGSMNLYDNVAFPLREHTKKSETEIRRI
VLEKLDMTGLNGADKKLPGEISGGMRKRAGLARALVLDPEIILVDEPDSGLDPVRTTYIS
QLFLDVNAQIDATFLIVTHNINLARTVPDNLGMLFRKELVMFGPREVLLTSEEPVVKQFL
NGKMQGPIGMSEEKDSAQMAAEQAMFEAGHHAGGVEDVSGVPPQMQPTPGVPTRMGAVRR
KDRVMEIMHRLPPAAQESIIESLSPEEQRHYGVRPHRGQPQQVGARPQGDGVPNQHHGQL
PADQVARIPGGQPPRTGTHRMPPNNGPGGR
selected fasta
>putative ABC transporter ATP-binding protein [putative ABC transporter ATP-binding protein]
ATGGGTGCCGAGGTGGTCATCGAAGGTCTGACGAAGTCCTTCGGTAAGCAGGCCATCTGG
CGGGACGTCACGTTGACGCTCCCCCCGGGCGAAGTGTCGGCCATGCTCGGCCCGTCGGGG
ACCGGCAAGTCGGTCTTCCTGAAGTCGATGATCGGGCTGCTCAAGCCCGACCGCGGCCGC
TGCATGATCAACGGGGTGGACATCGTCACCTGCTCCGAGCACAAGCTGTACGAGATCCGG
AAGCTCTTCGGTGTCCTCTTCCAGGACGGCGCGCTGTTCGGCTCGATGAACCTCTACGAC
AACGTCGCCTTCCCGCTGCGTGAGCACACGAAGAAGTCCGAGACGGAAATCCGCCGGATC
GTGCTCGAGAAGCTCGACATGACCGGTCTGAACGGCGCCGACAAGAAGCTGCCGGGCGAG
ATCTCCGGCGGGATGCGCAAGCGCGCCGGCCTGGCCCGCGCCCTGGTGCTCGACCCGGAG
ATCATCCTGGTCGACGAGCCGGACTCGGGCCTCGACCCGGTCCGCACCACCTACATCTCG
CAGCTGTTCCTCGACGTCAACGCGCAGATCGACGCGACGTTCCTGATCGTCACCCACAAC
ATCAACCTGGCCCGCACGGTGCCGGACAACCTGGGCATGCTCTTCCGCAAGGAACTGGTC
ATGTTCGGCCCGCGCGAGGTGCTGCTGACCAGCGAAGAGCCGGTCGTCAAGCAGTTCCTC
AACGGCAAGATGCAGGGCCCGATCGGCATGTCCGAGGAGAAGGACAGCGCCCAGATGGCC
GCCGAGCAGGCGATGTTCGAAGCCGGCCACCACGCGGGCGGGGTCGAGGACGTCTCCGGC
GTGCCGCCGCAGATGCAGCCGACGCCGGGCGTGCCCACCCGGATGGGTGCCGTCCGCCGC
AAGGACCGGGTCATGGAGATCATGCACCGGCTGCCGCCGGCCGCGCAGGAAAGCATCATC
GAGTCGCTGAGCCCCGAGGAGCAGCGCCACTACGGTGTGCGGCCGCACCGCGGGCAGCCG
CAGCAGGTCGGCGCCCGCCCGCAGGGTGACGGCGTCCCGAACCAGCACCACGGGCAGCTG
CCCGCCGACCAGGTGGCGCGGATCCCCGGCGGCCAGCCGCCGAGAACCGGCACGCACCGA
ATGCCACCGAACAACGGGCCAGGTGGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [44-167]  1.8e-15 PF00005
PF00005   ABC_tran
 [5-241]  22.943 PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [29-225]  4.5e-14 SM00382
SM00382   ATPases associated with a variety of cellula
IPR017871 ABC transporter, conserved site (Conserved_site)
 [141-155]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP
 [1-34]  0.186 Signal
Eukaryota   
TMHMM No significant hit