close all open/close all

CDS information : Rifam_00040


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction2,770 / 3,522 / + [in whole cluster]
2,770 / 3,522 / + [in contig]
Location2770..3522 [in whole cluster]
2770..3522 [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductYrbE family protein
Product (GenBank)putative ABC-transporter integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
  • mce operon
Note
Note (GenBank)
  • ORF22
Reference
ACC
Related Reference
ACC
O53546
PmId
[21345183] Single nucleotide polymorphism in the genes of mce1 and mce4 operons of Mycobacterium tuberculosis: analysis of clinical isolates and standard reference strains. (BMC Microbiol. , 2011)

close this sectionSequence

selected fasta
>YrbE family protein [putative ABC-transporter integral membrane protein]
MLRETGNLFALGLDIVRGLFQRPFQLREFIQQSWFIASVTILPTALVAIPFGAVISLQFG
SLARQLGAQSYTGAGSVLATVQQASPLVTALLVAGAGGSAVCADIGARTIREEIAAMEVL
GVSAVQRLIVPRTLAMMLVALLLNGMVSVIGVLGGYFFNVVLQGGTPGAYLASFSALAQL
PDLWVGELKALIFGFIAAVVASYRGLNPSGGPKGVGDAVNQSVVITFLLLFVVNFVITLI
YLQIVPGKLD
selected fasta
>YrbE family protein [putative ABC-transporter integral membrane protein]
ATGCTCCGCGAGACCGGGAACCTGTTCGCTCTCGGCCTGGACATCGTCCGCGGCCTGTTC
CAGCGCCCGTTCCAGCTGCGGGAGTTCATCCAGCAGTCGTGGTTCATCGCGAGCGTGACG
ATCCTGCCGACGGCCCTGGTGGCCATCCCGTTCGGTGCCGTCATCTCGCTGCAGTTCGGG
TCGCTCGCCCGCCAGCTGGGCGCGCAGTCCTACACCGGCGCGGGCTCCGTGCTCGCCACC
GTGCAGCAGGCCAGTCCGCTGGTCACCGCGCTGCTGGTGGCGGGTGCGGGCGGCTCCGCC
GTCTGCGCCGACATCGGCGCCCGGACCATCCGCGAAGAGATCGCCGCGATGGAGGTGCTC
GGCGTCTCCGCGGTGCAGCGGCTGATCGTGCCGCGCACCCTCGCGATGATGCTGGTCGCG
CTCCTGCTCAACGGCATGGTCAGCGTCATCGGCGTGCTCGGCGGCTACTTCTTCAACGTC
GTGCTGCAGGGCGGGACGCCGGGTGCGTACCTGGCGAGCTTCTCCGCCCTCGCGCAGCTG
CCCGACCTCTGGGTCGGCGAGCTCAAGGCGCTGATCTTCGGGTTCATCGCCGCCGTCGTC
GCGTCCTACCGGGGCCTGAACCCCTCCGGCGGCCCGAAGGGCGTCGGGGACGCGGTGAAC
CAGTCGGTGGTCATCACGTTCCTGCTGCTGTTCGTCGTGAACTTCGTGATCACCCTGATC
TACCTGCAGATCGTGCCCGGAAAGCTGGACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003453 Permease domain (Domain)
 [27-241]  1.7e-65 PF02405
PF02405   Permease
SignalP
 [1-18]  0.204 Signal
Eukaryota   
TMHMM
 [34-56]  Transmembrane (i-o) [79-101]  Transmembrane (o-i) [138-160]  Transmembrane (i-o) [180-202]  Transmembrane (o-i) [223-245]  Transmembrane (i-o)
Transmembrane 5