close all open/close all

CDS information : Rifam_00050


close this sectionLocation

Organism
StrainS699
Entry nameRifamycin
Contig
Start / Stop / Direction3,527 / 4,363 / + [in whole cluster]
3,527 / 4,363 / + [in contig]
Location3527..4363 [in whole cluster]
3527..4363 [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductYrbE family protein
Product (GenBank)putative ABC-transporter permease
Gene
Gene (GenBank)
EC number
Keyword
  • mce operon
Note
Note (GenBank)
  • ORF23
Reference
ACC
Related Reference
ACC
O53545
PmId
[21345183] Single nucleotide polymorphism in the genes of mce1 and mce4 operons of Mycobacterium tuberculosis: analysis of clinical isolates and standard reference strains. (BMC Microbiol. , 2011)

close this sectionSequence

selected fasta
>YrbE family protein [putative ABC-transporter permease]
MTFLQGAKRVVNRPLQTLDTLGDQMSFYGRALLWTPRTLRRYTKEVLRLLAEVSFGSGSL
AVIGGTVGVMVGLTLFTGVLVGLQGYSALNSIGTSAFTGFLTAFFNTREIAPLVAGLALS
ATVGAGFTAQLGAMRISEEIDALEVMGVPSLPYLVTTRIIAGFVAVIPLYIIGLLSSYLA
SRLVVIYIYHQSAGTYDHYFDLFLPPQDVLYSFIKVLLFSVLIILSHCYFGYRATGGPAG
VGVAVGKAVRLSIVTVSIMNFFIGFAIWGTDVTVRIAG
selected fasta
>YrbE family protein [putative ABC-transporter permease]
ATGACGTTCCTCCAGGGCGCGAAACGCGTCGTCAACCGACCCCTCCAGACACTGGACACC
TTGGGTGACCAGATGTCGTTCTACGGCCGCGCGCTGCTGTGGACGCCGCGGACGCTGCGC
CGCTACACCAAAGAGGTGCTCCGGCTGCTGGCCGAGGTGAGCTTCGGGTCCGGCTCGCTG
GCGGTCATCGGCGGCACGGTGGGCGTGATGGTCGGCCTGACGCTGTTCACCGGTGTCCTC
GTCGGCCTCCAGGGCTATTCGGCGCTGAACTCGATCGGGACGTCGGCCTTCACCGGCTTC
CTGACCGCGTTCTTCAACACGCGCGAGATCGCCCCGCTGGTCGCCGGGCTCGCCCTGAGC
GCCACCGTCGGCGCCGGGTTCACCGCGCAGCTGGGCGCCATGCGGATCTCGGAGGAGATC
GACGCACTGGAAGTCATGGGTGTGCCGAGCCTGCCGTACCTGGTGACGACGCGGATCATC
GCCGGGTTCGTCGCGGTCATCCCGCTCTACATCATCGGCCTGCTGAGCTCGTACCTCGCG
TCGAGACTGGTCGTGATCTACATCTACCACCAGTCGGCCGGTACCTACGACCACTACTTC
GACCTGTTCCTGCCCCCGCAGGACGTGCTGTATTCGTTCATCAAGGTGCTGCTGTTCAGC
GTCCTGATCATCCTGTCGCACTGCTACTTCGGGTACCGGGCGACCGGTGGCCCGGCCGGG
GTCGGCGTCGCGGTCGGCAAGGCCGTGCGGCTGTCCATCGTCACGGTGTCGATCATGAAC
TTCTTCATCGGGTTCGCCATCTGGGGAACCGACGTCACGGTAAGGATCGCGGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003453 Permease domain (Domain)
 [45-264]  1.2e-64 PF02405
PF02405   Permease
SignalP No significant hit
TMHMM
 [49-71]  Transmembrane (i-o) [86-105]  Transmembrane (o-i) [112-134]  Transmembrane (i-o) [154-176]  Transmembrane (o-i) [183-200]  Transmembrane (i-o) [210-232]  Transmembrane (o-i) [248-270]  Transmembrane (i-o)
Transmembrane 7